Align O-acetylhomoserine aminocarboxypropyltransferase (EC 2.5.1.49) (characterized)
to candidate WP_092056754.1 BQ4888_RS09545 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase
Query= BRENDA::Q187D4 (421 letters) >NCBI__GCF_900111775.1:WP_092056754.1 Length = 425 Score = 469 bits (1207), Expect = e-137 Identities = 225/416 (54%), Positives = 302/416 (72%) Query: 5 ETICVQGNYKPGNGEPRVLPLYQSTTFKYSSIDQLAELFDLKVDGHIYSRISNPTIQAFE 64 ET VQG Y P E R+ + QSTTFKY S + +A+LFDL + Y+R+ NPT AFE Sbjct: 8 ETQAVQGTYAPKATEARIPTICQSTTFKYDSAEHVAKLFDLDLPDPFYTRLGNPTTDAFE 67 Query: 65 EKISLLEGGVSSVAVSSGQSANMLAVLNICKSGDSILCSSKVYGGTFNLLGPSLKKFGID 124 KI+L+EGGV ++A SSGQ+A L+++NIC++G I+ + +YGGT++L +L K GI+ Sbjct: 68 GKIALMEGGVGALATSSGQAATALSIMNICRAGQHIVTAGTLYGGTYSLFANTLPKLGIE 127 Query: 125 LISFDLDSSEDEIVELAKENTKVVFAETLANPTLEVIDFEKIANVAKRINVPFIVDNSLA 184 + + DSS +EI + + TK +FAET+ NP L V+DFEK + VA+ VP ++DN+ Sbjct: 128 VSFVNPDSSAEEIKKHFRPETKALFAETIGNPGLNVLDFEKFSAVARATGVPLLIDNTFP 187 Query: 185 SPVLCNPLKYGANIVTHSTTKYLDGHASSVGGIIVDGGNFNWDNGKFPELVEPDPTYHGI 244 +P LC PL +GA+IV HS TKY+DGHASS+GG+IVDGG F+W +GKFPEL EPD +YHG+ Sbjct: 188 TPYLCRPLDHGADIVIHSATKYIDGHASSLGGVIVDGGKFDWTSGKFPELTEPDSSYHGL 247 Query: 245 SYTQKFGNAAYATKARVQLLRDYGNCLSPFNAYLTNLNVETLHLRMERHSENALKIARFL 304 Y +KFG +AY KAR Q +RD G SPFN++L + + TL LRMERHS NAL +A FL Sbjct: 248 RYVEKFGPSAYIVKARAQYMRDLGVTPSPFNSFLFHQGLTTLPLRMERHSANALALAHFL 307 Query: 305 EKHENVDWINYPGLEDNKYYENAKKYLSRGCSGVLSFGVRGGLENAKKFVEKLQIASLVT 364 + H V W+NYPGLE + Y A++Y+ +G SGVL+FG++G E +F+E +I +LV Sbjct: 308 QGHPKVSWVNYPGLESHPSYPLAQRYMPKGASGVLTFGIKGAREAGIRFMEATRIIALVV 367 Query: 365 HVSDVRTCVIHPASTTHRQLTEEQLIASGVLPSLIRLSVGIENVEDLIADLNQALN 420 HV D R+CV+HPASTTHRQL+E Q IASGV P LIRLSVGIE+++DLIAD+ QALN Sbjct: 368 HVGDARSCVLHPASTTHRQLSEAQQIASGVTPDLIRLSVGIEHIDDLIADVEQALN 423 Lambda K H 0.316 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 502 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 425 Length adjustment: 32 Effective length of query: 389 Effective length of database: 393 Effective search space: 152877 Effective search space used: 152877 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory