Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54); chorismate mutase (EC 5.4.99.5) (characterized)
to candidate WP_092057221.1 BQ4888_RS10820 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::P39912 (358 letters) >NCBI__GCF_900111775.1:WP_092057221.1 Length = 339 Score = 269 bits (688), Expect = 7e-77 Identities = 131/263 (49%), Positives = 182/263 (69%), Gaps = 1/263 (0%) Query: 95 LVSRKKKPEDTIVDIKGE-KIGDGQQRFIVGPCAVESYEQVAEVAAAAKKQGIKILRGGA 153 L SR+ KPE + VD+ G +G GQ + GPC+VES Q+ E A A K G +LRGGA Sbjct: 72 LASREVKPEPSTVDLGGGVTVGGGQLVVMAGPCSVESEAQILETAHAVKAAGATVLRGGA 131 Query: 154 FKPRTSPYDFQGLGVEGLQILKRVADEFDLAVISEIVTPAHIEEALDYIDVIQIGARNMQ 213 FKPRTSPY FQG+ +GL++L + L +++E+V P ++ Y D++Q+GARN+Q Sbjct: 132 FKPRTSPYSFQGMEEDGLKLLALAREATGLPIVTEVVNPRDVDLVARYADIMQVGARNIQ 191 Query: 214 NFELLKAAGAVKKPVLLKRGLAATISEFINAAEYIMSQGNDQIILCERGIRTYETATRNT 273 NF LLK G + KP+LLKRG+A+TI EF+ +AEYI+++GN +++LCERGIRT+ETATRNT Sbjct: 192 NFALLKMLGQLDKPILLKRGMASTIQEFLMSAEYILAEGNRRVLLCERGIRTFETATRNT 251 Query: 274 LDISAVPILKQETHLPVFVDVTHSTGRRDLLLPTAKAALAIGADGVMAEVHPDPSVALSD 333 LDISAVP+LK++THLP+ +D +H+TG L+ A +A G DG++ EVHP P A SD Sbjct: 252 LDISAVPVLKEQTHLPIIIDPSHATGHASLVPSMCYAGVAAGCDGLIVEVHPCPEKAASD 311 Query: 334 SAQQMAIPEFEKWLNELKPMVKV 356 Q + EF + +L+ KV Sbjct: 312 GPQSLRPAEFAAMMAKLREFAKV 334 Lambda K H 0.316 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 339 Length adjustment: 29 Effective length of query: 329 Effective length of database: 310 Effective search space: 101990 Effective search space used: 101990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory