Align aspartate semialdehyde dehydrogenase (EC 1.2.1.11) (characterized)
to candidate WP_092344173.1 BLU87_RS01575 aspartate-semialdehyde dehydrogenase
Query= metacyc::AT1G14810-MONOMER (375 letters) >NCBI__GCF_900107645.1:WP_092344173.1 Length = 356 Score = 335 bits (860), Expect = 9e-97 Identities = 170/340 (50%), Positives = 238/340 (70%), Gaps = 8/340 (2%) Query: 36 ESAPSLAVVGVTGAVGQEFLSVLSDRDFPYSSIKMLASKRSAGKRVAFDGHEYTVEELTA 95 + A ++A+ G TGAVG+ FL++L R+FP +++K+ ASKRS GK+V F G YT+EELT Sbjct: 9 KEAYNVAIAGATGAVGETFLNILEQRNFPINTLKLYASKRSKGKQVTFKGTTYTIEELTE 68 Query: 96 DSFNGVDIALFSAGGSISKEFGPLAAEKGTIVVDNSSAFRMVDGVPLVIPEVNPEAMKGI 155 DSF +DIALFSAGG+ SK++ P A + G +VVDNSSAFR+ VPLV+PEVNPE + Sbjct: 69 DSFKDIDIALFSAGGAQSKKYAPFAVKAGAVVVDNSSAFRLDPEVPLVVPEVNPEDV--- 125 Query: 156 KVGMGKGALIANPNCSTIICLMAVTPLHHHAKVKRMVVSTYQAASGAGAAAMEELVQQTR 215 + +I+NPNC+TII L+A+ PLH +++VK++ VSTYQ+ASGAGA AMEEL QQ R Sbjct: 126 ---VWHNGIISNPNCTTIIMLVALKPLHDYSRVKQVFVSTYQSASGAGAQAMEELKQQVR 182 Query: 216 EVLEGKPPTCNIFGQQYAFNLFSHNAPILDNGYNEEEMKLVKETRKIWNDTEVKVTATCI 275 + G+ + N F Q +N+ H DNGY EEMK+ ET+KI +D EV+V+ATC+ Sbjct: 183 DWAAGRDLSVNKFTHQLLYNVIPHIDTFQDNGYTGEEMKMFNETKKILHDDEVRVSATCV 242 Query: 276 RVPVMRAHAESVNLQFENPLDENTAREILKKAPGVYIIDDRASNTFPTPLDVSNKDDVAV 335 R+PV+ +H+ESV + E P+ ARE+ APG+ + D+ +P PL +DD V Sbjct: 243 RIPVLYSHSESVTVMTEEPISPEKARELFNNAPGLKVNDNPDGCEYPMPLGSQFQDDCYV 302 Query: 336 GRIRRDVSQDGNFGLDIFVCGDQIRKGAALNAVQIAEMLL 375 GRIR +++ + L+ ++ GDQIRKGAALNA+QIAE+L+ Sbjct: 303 GRIRENIAAEN--ALNFWISGDQIRKGAALNAIQIAELLV 340 Lambda K H 0.318 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 356 Length adjustment: 30 Effective length of query: 345 Effective length of database: 326 Effective search space: 112470 Effective search space used: 112470 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_092344173.1 BLU87_RS01575 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.1136.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-143 461.7 0.0 7.9e-143 461.5 0.0 1.0 1 lcl|NCBI__GCF_900107645.1:WP_092344173.1 BLU87_RS01575 aspartate-semialde Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900107645.1:WP_092344173.1 BLU87_RS01575 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 461.5 0.0 7.9e-143 7.9e-143 1 339 [] 13 342 .. 13 342 .. 0.99 Alignments for each domain: == domain 1 score: 461.5 bits; conditional E-value: 7.9e-143 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsa 69 nvai GatGavG+++l++Le+rnfpi++l+l+as+rs+Gk+v+fkg +++ee+++ sf++idialfsa lcl|NCBI__GCF_900107645.1:WP_092344173.1 13 NVAIAGATGAVGETFLNILEQRNFPINTLKLYASKRSKGKQVTFKGTTYTIEELTEDSFKDIDIALFSA 81 79******************************************************************* PP TIGR01296 70 GgsvskefapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkp 138 Gg+ sk++ap a+kag++v+Dn+safrld++vPLvvpevn e++ ++ gii+nPnC+ti ++v+Lkp lcl|NCBI__GCF_900107645.1:WP_092344173.1 82 GGAQSKKYAPFAVKAGAVVVDNSSAFRLDPEVPLVVPEVNPEDVVWHN--GIISNPNCTTIIMLVALKP 148 ***********************************************9..******************* PP TIGR01296 139 lkdeaklkrvvvstYqavsGaGkkgveeLknqtkavlegkekepeidalkakkfakqiafnaiplidkl 207 l+d ++k+v vstYq+ sGaG++++eeLk+q++ + g++ ++ +kf++q+ +n+ip+id++ lcl|NCBI__GCF_900107645.1:WP_092344173.1 149 LHDYSRVKQVFVSTYQSASGAGAQAMEELKQQVRDWAAGRDLSV-------NKFTHQLLYNVIPHIDTF 210 ****************************************9997.......9***************** PP TIGR01296 208 kedGytkeelkllfetrkilgiedlkvsatcvrvPvftghsesvsiefekelsveevkelLkeapgvvv 276 +++Gyt ee+k+ +et+kil++++++vsatcvr+Pv+++hsesv++ +e+++s+e+++el+++apg++v lcl|NCBI__GCF_900107645.1:WP_092344173.1 211 QDNGYTGEEMKMFNETKKILHDDEVRVSATCVRIPVLYSHSESVTVMTEEPISPEKARELFNNAPGLKV 279 ********************************************************************* PP TIGR01296 277 iddpsenlyptPleavgkdevfvgrirkDlskekglalfvvaDnlrkGaalnavqiaellike 339 d+p++ +yp+Pl + +d+ +vgrir+++ e++l+ ++++D++rkGaalna+qiaell+k+ lcl|NCBI__GCF_900107645.1:WP_092344173.1 280 NDNPDGCEYPMPLGSQFQDDCYVGRIRENIAAENALNFWISGDQIRKGAALNAIQIAELLVKN 342 ************************************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (356 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.57 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory