Align Imidazole glycerol phosphate synthase subunit HisF; EC 4.3.2.10; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF (uncharacterized)
to candidate WP_092345231.1 BLU87_RS04765 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
Query= curated2:A4YI34 (251 letters) >NCBI__GCF_900107645.1:WP_092345231.1 Length = 243 Score = 113 bits (282), Expect = 4e-30 Identities = 76/237 (32%), Positives = 115/237 (48%), Gaps = 10/237 (4%) Query: 6 IIACLDVKDGKVVK---GVRFLDLKLKGDPAELASRYEEEGADEIVFLDISATVEGRKTL 62 I+ +D+K G V+ G+ D DPA A ++++G + + +D+ G Sbjct: 3 ILPAIDLKGGHCVRLEQGLMDKDTVYNDDPAAQALLWQQQGGEFLHIVDLDGAFAGVPKN 62 Query: 63 LEKVRETASVLSIPLTVGGGVRTVEDVSNLLSNGADKVSLNTVAAENPSVVSMASREFGA 122 ++ + ++IP +GGG+R +E + L G +V L TVA ENP++V A R+F Sbjct: 63 KSAIQSIVNAINIPSELGGGIRDLETIEAYLDLGITRVILGTVAKENPALVKEACRKFPG 122 Query: 123 QAVVVAIDAKRVGNGWRVFVRSGTKDTGLDAVDWAKRVEEMGAGEILLTSIDRDGTRDGY 182 Q +VV IDAK V VR T A + AK +E G I+ T I RDG G Sbjct: 123 Q-IVVGIDAK----DGLVAVRGWADVTEKKATEMAKEMEGFGVEAIIYTDISRDGMMQGP 177 Query: 183 DLELTKAVVRATKVPVIASGGAGKPDHF--LSVFRQAGADAALAAGIFHDGVIRIRE 237 ++E T+A+ A +PVIASGG D L +G + + G I +RE Sbjct: 178 NIEATRALAEAIIIPVIASGGLSTLDDIRKLLQIESSGVTGVITGKAIYSGAIDLRE 234 Lambda K H 0.317 0.135 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 243 Length adjustment: 24 Effective length of query: 227 Effective length of database: 219 Effective search space: 49713 Effective search space used: 49713 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory