Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_092345303.1 BLU87_RS04965 ornithine--oxo-acid transaminase
Query= BRENDA::O30508 (406 letters) >NCBI__GCF_900107645.1:WP_092345303.1 Length = 400 Score = 247 bits (630), Expect = 5e-70 Identities = 140/391 (35%), Positives = 215/391 (54%), Gaps = 6/391 (1%) Query: 14 DRYMVPNYAPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQR 73 D+Y NY P + RG+G VWD G + +D + + GH HP +++A+ QA++ Sbjct: 11 DQYGAHNYKPLDVVLTRGKGVWVWDVDGNKYLDCLAAYSAVNQGHCHPKIMQAMVTQAEK 70 Query: 74 IWHVSNVFTNEPALRLARKLVDATFAERVFLANSGAEANEAAFKLARRYANDVYG-PQ-K 131 + S F N+ ++L + T + +V NSGAEA E A K R++ V G PQ K Sbjct: 71 LTLTSRAFRNDQLGPFYQELCELTHSHKVLPMNSGAEAVETAIKTVRKWGYLVKGVPQDK 130 Query: 132 YEIIAASNSFHGRTLFTVNVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAISDKTCAVV 191 EII +N+FHGRT+ V+ GFGP G +P+ D A + AI+ T A + Sbjct: 131 AEIIVCANNFHGRTISIVSFSTDENARAGFGPFTPGFKCIPFGDAAAFETAITANTVAFL 190 Query: 192 LEPIQGEGGVLPAQQAYLEGARKLCDEHNALLVFDEVQSGMGRVGELFAYMHYGVVPDIL 251 +EPIQGE GV+ YL+ R++ D HN +L+ DE+Q+G+GR G+L + G+ D+ Sbjct: 191 VEPIQGEAGVIIPPDDYLKQVREISDRHNVVLILDEIQTGLGRTGKLLTEEYAGIEADLT 250 Query: 252 SSAKSLGGGF-PIGAMLTTGEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDG 310 K+L GGF P+ A+L+ E+ L G HG+T+GGNPLA AVA AAL V+ +++ Sbjct: 251 LIGKALSGGFYPVSAVLSNTEVMDVLQPGEHGSTFGGNPLACAVARAALKVLFEENLIEN 310 Query: 311 VKAKHERFKSRLQKIGQEYGIFDEIRGMGLLIGAALTDEWKGKARDVLNAAEKEAVMVLQ 370 + E F + L+KI + E+RG GL++ E G AR +++ ++ Sbjct: 311 SYEQGEYFLNELKKISHPH--IKEVRGRGLMLAIEFHPE-VGGARGYCYKLKEQGILAKD 367 Query: 371 ASPDVVRFAPSLVIDDAEIDEGLERFERAVA 401 +++RFAP LVI E+D LE + ++ Sbjct: 368 THENIIRFAPPLVIKREEVDLILEAINQVLS 398 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 400 Length adjustment: 31 Effective length of query: 375 Effective length of database: 369 Effective search space: 138375 Effective search space used: 138375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory