Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate WP_092350113.1 BLU87_RS14535 glutamate-1-semialdehyde-2,1-aminomutase
Query= curated2:P59318 (401 letters) >NCBI__GCF_900107645.1:WP_092350113.1 Length = 427 Score = 141 bits (355), Expect = 4e-38 Identities = 100/323 (30%), Positives = 160/323 (49%), Gaps = 29/323 (8%) Query: 38 PFVLARGQGARVWDMDGREYLDLIGGIATCALGHCHPEVVAAAKAQLDSLWHVSNVFYSQ 97 P +A+ G++++D+DG EY+D +G LGHCHP+VV A + S + Sbjct: 35 PIFIAKAAGSKIYDVDGNEYIDYVGSWGPMILGHCHPKVVEAIQKTA-----ASGASFGA 89 Query: 98 P---QIDLAAQLTE-WSGLSRAFFCNSGAEANEALLKLTRKVMKDRGTPERFEVISFDSS 153 P + +LA + E + + + +SG EA + ++L RG R +++ FD Sbjct: 90 PTPLETELAEIVCEAYPNIEKVRMVSSGTEATMSAIRLA------RGYTGRDKILKFDGC 143 Query: 154 FHGR--TLATVTATGQAKYQKGFEP-LPAGFTH----VPYGDLEAVRKAVGP---ATAAI 203 +HG +L +G A + P +PA F Y DL V++ V A I Sbjct: 144 YHGHADSLLVKAGSGLATFGVPTSPGVPADFAKYTLTANYNDLANVQELVAANKGEIACI 203 Query: 204 LVEPIQGEGGVRMAPLGFLVGLRALCDEHGLLLLVDEVQTGMGRTGKPFGFMHEGIVPDG 263 ++E + G G GFL LR LC G++L++DEV TG R G+ D Sbjct: 204 ILEAVAGNMGCVPPVKGFLQELRDLCTAEGIILIIDEVMTGF-RVAYGGAQERFGVRGDL 262 Query: 264 ISVAKALGNGLPIGAMLCKEELGASLTP--GTH-GSTFGGNPVAAAAANAVVRILRRPGF 320 + + K +G GLP+GA K E+ SL+P G + T GNP+A +A A +++L++ GF Sbjct: 263 VCLGKIIGGGLPVGAFGGKREIMDSLSPEGGVYQAGTLSGNPLAMSAGIATLKLLQQEGF 322 Query: 321 LDEVQEKGAYLLARARELQGRLP 343 +++EK AYL +++ G P Sbjct: 323 YQQLEEKAAYLEKGVQQVAGNSP 345 Lambda K H 0.319 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 427 Length adjustment: 31 Effective length of query: 370 Effective length of database: 396 Effective search space: 146520 Effective search space used: 146520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory