Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_092350344.1 BLU87_RS15100 aspartate/tyrosine/aromatic aminotransferase
Query= BRENDA::A0A140ND68 (396 letters) >NCBI__GCF_900107645.1:WP_092350344.1 Length = 396 Score = 455 bits (1170), Expect = e-132 Identities = 219/396 (55%), Positives = 280/396 (70%) Query: 1 MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENE 60 MFE + AP DPILGL + F+AD P KINL +GVY+D +G+TPVL +VK+AE+ +LE E Sbjct: 1 MFEKVQIAPPDPILGLTETFKADPNPDKINLSVGVYQDSSGRTPVLETVKEAEKRILEQE 60 Query: 61 TTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSV 120 +K YL + G P + QELLFG G +I+ KRA TAQ PGGTGALRVA D+L Sbjct: 61 DSKGYLSMTGAPVYCAVVQELLFGAGHEIIDSKRAATAQCPGGTGALRVAGDYLHFVHPG 120 Query: 121 KRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGC 180 ++W+SNP+W NH ++F +AGL +YAY + E + LDFDA+ S+ GDV+L HGC Sbjct: 121 AKIWLSNPTWANHNTIFGAAGLTCEQYAYRNPETNGLDFDAMCESIKTIPKGDVILLHGC 180 Query: 181 CHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIV 240 CHNPTGIDPT EQW + L ++ LPL DFAYQG A G+EED GL K++++ Sbjct: 181 CHNPTGIDPTPEQWAIIGDLLAKQEVLPLVDFAYQGLANGIEEDRTGLLELVKKVKQMLI 240 Query: 241 ASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN 300 SS+SKNFGLY ER GA T+VA D++ + SQ+K IR NYSNPP+HG +VA +LS+ Sbjct: 241 CSSFSKNFGLYRERTGALTIVADDAQQANTVMSQVKLRIRYNYSNPPSHGGQIVAVVLSD 300 Query: 301 DALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLR 360 L+A W +E+ +R RI MR LFV TL+EKG +DF+ II+Q GMFSFSGLTKEQV R Sbjct: 301 KELKAKWYKEVAGIRSRINEMRHLFVKTLKEKGVKQDFNSIIEQRGMFSFSGLTKEQVAR 360 Query: 361 LREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 396 LR+E+ +Y V SGR+NVAGMTP NM LCEAI AV+ Sbjct: 361 LRDEYSIYIVGSGRINVAGMTPSNMDRLCEAIKAVV 396 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 507 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 396 Length adjustment: 31 Effective length of query: 365 Effective length of database: 365 Effective search space: 133225 Effective search space used: 133225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory