Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate WP_092350927.1 BLU87_RS16645 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::Q9WYH8 (338 letters) >NCBI__GCF_900107645.1:WP_092350927.1 Length = 340 Score = 330 bits (845), Expect = 4e-95 Identities = 167/336 (49%), Positives = 233/336 (69%), Gaps = 5/336 (1%) Query: 1 MIVVLKPGSTEEDIRKVVKLAESYNLKCHISKGQERTVIGIIGDDR-YVVADKFESLDCV 59 MI+V++ + + D+ V K + HI G+ R VIG +G++R +S+ V Sbjct: 1 MIIVMQKDAAKSDLESVEKKIIELGYQPHIIYGETRNVIGAVGEERGKEKLQTLQSMSGV 60 Query: 60 ESVVRVLKPYKLVSREFHPEDTVIDL-GDVKIGNGYFTIIAGPCSVEGREMLMETAHFLS 118 E+VV +LK YKL SRE P+ + +++ + IG F + AGPC+VE R+ + +TA + Sbjct: 61 ENVVPILKAYKLASREVQPQSSEVEIVPGLTIGGKEFVVAAGPCAVEDRDQICDTAVAVK 120 Query: 119 ELGVKVLRGGAYKPRTSPYSFQGLGEKGLEYLREAADKYGMYVVTEALGEDDLPKVAEYA 178 + G ++LRGGAYKPRTSPYSFQG+ E GL+ L EA + G+ +VTE + D+ VA YA Sbjct: 121 QAGARLLRGGAYKPRTSPYSFQGMEEDGLKLLAEAREITGLPIVTEVVNPRDVELVARYA 180 Query: 179 DIIQIGARNAQNFRLLSKAGSYNKPVLLKRGFMNTIEEFLLSAEYIANSGNTKIILCERG 238 D++Q+GARN QNF LL G +KP+LLKRG TI+EFL+SAEYI + GN ++ILCERG Sbjct: 181 DVMQVGARNTQNFALLKMLGQLDKPILLKRGMSTTIQEFLMSAEYILSEGNRRVILCERG 240 Query: 239 IRTFEKATRNTLDISAVPIIRKESHLPILVDPSHSGGRRDLVIPLSRAAIAVGAHGIIVE 298 IRTFE ATRNTLDISAVP++++++HLP+++DPSH+ G L+ P+S AA A GA G+IVE Sbjct: 241 IRTFETATRNTLDISAVPVLKQQTHLPVIIDPSHATGHASLIAPMSYAAAAAGADGLIVE 300 Query: 299 VHPEPEKALSDGKQSL---DFELFKELVQEMKKLAD 331 VHP PEKA SDG QSL DF++ + ++E K+AD Sbjct: 301 VHPCPEKATSDGPQSLRPDDFQVMMDKLREFVKVAD 336 Lambda K H 0.318 0.138 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 340 Length adjustment: 28 Effective length of query: 310 Effective length of database: 312 Effective search space: 96720 Effective search space used: 96720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_092350927.1 BLU87_RS16645 (3-deoxy-7-phosphoheptulonate synthase)
to HMM TIGR01361 (aroF: 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01361.hmm # target sequence database: /tmp/gapView.2069.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01361 [M=260] Accession: TIGR01361 Description: DAHP_synth_Bsub: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-123 395.2 0.0 7.8e-123 394.9 0.0 1.1 1 lcl|NCBI__GCF_900107645.1:WP_092350927.1 BLU87_RS16645 3-deoxy-7-phosphoh Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900107645.1:WP_092350927.1 BLU87_RS16645 3-deoxy-7-phosphoheptulonate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 394.9 0.0 7.8e-123 7.8e-123 2 258 .. 72 329 .. 71 331 .. 0.97 Alignments for each domain: == domain 1 score: 394.9 bits; conditional E-value: 7.8e-123 TIGR01361 2 laskkvkkee.tvvdvedvkiGegeliviaGPCsveseeqivetakavkeaGakllrGgafkPrtsPys 69 las++v++++ v+ v +++iG++e++v+aGPC+ve+++qi +ta avk+aGa+llrGga+kPrtsPys lcl|NCBI__GCF_900107645.1:WP_092350927.1 72 LASREVQPQSsEVEIVPGLTIGGKEFVVAAGPCAVEDRDQICDTAVAVKQAGARLLRGGAYKPRTSPYS 140 67888887651678899**************************************************** PP TIGR01361 70 fqGlgeeglkllkrakdetgllvvtevlderdveivaeyvDilqiGarnmqnfelLkevgkskkPvlLk 138 fqG++e+glkll++a++ tgl++vtev+++rdve+va+y+D++q+Garn+qnf+lLk +g+ +kP+lLk lcl|NCBI__GCF_900107645.1:WP_092350927.1 141 FQGMEEDGLKLLAEAREITGLPIVTEVVNPRDVELVARYADVMQVGARNTQNFALLKMLGQLDKPILLK 209 ********************************************************************* PP TIGR01361 139 rglaatieewleaaeYilsegnenvilcerGirtfekatrftldlsavallkklthlPvivDpshaaGr 207 rg+++ti+e+l++aeYilsegn +vilcerGirtfe+atr+tld+sav++lk++thlPvi+Dpsha+G+ lcl|NCBI__GCF_900107645.1:WP_092350927.1 210 RGMSTTIQEFLMSAEYILSEGNRRVILCERGIRTFETATRNTLDISAVPVLKQQTHLPVIIDPSHATGH 278 ********************************************************************* PP TIGR01361 208 rdlvlplakaavavGadgllievhpdPekalsDseqqltpeefkelvkelk 258 +l+ p++ aa a+Gadgl++evhp Peka sD++q+l+p++f+ ++++l+ lcl|NCBI__GCF_900107645.1:WP_092350927.1 279 ASLIAPMSYAAAAAGADGLIVEVHPCPEKATSDGPQSLRPDDFQVMMDKLR 329 ************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (260 nodes) Target sequences: 1 (340 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.15 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory