Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate WP_092481604.1 BM299_RS01045 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::Q9YEJ7 (270 letters) >NCBI__GCF_900115975.1:WP_092481604.1 Length = 273 Score = 300 bits (768), Expect = 2e-86 Identities = 155/258 (60%), Positives = 188/258 (72%) Query: 8 KLALKSEERRETVVEVEGVRIGGGSKAVIAGPCSVESWEQVREAALAVKEAGAHMLRGGA 67 KL + +R TVV V RIG G+ AVIAGPC+VE E + + A +K G H+LRGGA Sbjct: 5 KLVSRENKRENTVVRVGDCRIGAGAPAVIAGPCAVEDEEMLVKLACRLKRMGVHILRGGA 64 Query: 68 FKPRTSPYSFQGLGLEGLKLLRRAGDEAGLPVVTEVLDPRHVETVSRYADMLQIGARNMQ 127 +KPRTSPYSFQGLG +GL++L AG AGLPV+TE+ D RH+ V RYAD++QIG+RNMQ Sbjct: 65 YKPRTSPYSFQGLGKDGLRILADAGRVAGLPVITELTDVRHLPEVCRYADIIQIGSRNMQ 124 Query: 128 NFPLLREVGRSGKPVLLKRGFGNTVEELLAAAEYILLEGNWQVVLVERGIRTFEPSTRFT 187 NF LL+EVGR PVLLKRG T+EE L AAEYIL EGN +V+L ERGIR FE TR T Sbjct: 125 NFELLKEVGRVNFPVLLKRGLSATLEEWLLAAEYILAEGNREVILCERGIRGFETYTRNT 184 Query: 188 LDVAAVAVLKEATHLPVIVDPSHPAGRRSLVPALAKAGLAAGADGLIVEVHPNPEEALSD 247 D+ AVA +K +HLP++ DPSH GRR LV +A+A LAAGADGL++EVHPNPE ALSD Sbjct: 185 FDINAVAAVKYLSHLPLVADPSHGTGRRELVLPVARAALAAGADGLMLEVHPNPENALSD 244 Query: 248 AKQQLTPGEFARLMGELR 265 Q L P E A M +L+ Sbjct: 245 GPQSLRPEELAVFMQDLQ 262 Lambda K H 0.318 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 270 Length of database: 273 Length adjustment: 25 Effective length of query: 245 Effective length of database: 248 Effective search space: 60760 Effective search space used: 60760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_092481604.1 BM299_RS01045 (3-deoxy-7-phosphoheptulonate synthase)
to HMM TIGR01361 (aroF: 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01361.hmm # target sequence database: /tmp/gapView.2965.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01361 [M=260] Accession: TIGR01361 Description: DAHP_synth_Bsub: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-122 394.4 0.0 1.2e-122 394.2 0.0 1.0 1 lcl|NCBI__GCF_900115975.1:WP_092481604.1 BM299_RS01045 3-deoxy-7-phosphoh Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900115975.1:WP_092481604.1 BM299_RS01045 3-deoxy-7-phosphoheptulonate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 394.2 0.0 1.2e-122 1.2e-122 2 258 .. 6 262 .. 5 264 .. 0.99 Alignments for each domain: == domain 1 score: 394.2 bits; conditional E-value: 1.2e-122 TIGR01361 2 laskkvkkeetvvdvedvkiGegeliviaGPCsveseeqivetakavkeaGakllrGgafkPrtsPysf 70 l+s++ k+e+tvv+v d +iG g ++viaGPC+ve+ee++v++a ++k+ G+++lrGga+kPrtsPysf lcl|NCBI__GCF_900115975.1:WP_092481604.1 6 LVSRENKRENTVVRVGDCRIGAGAPAVIAGPCAVEDEEMLVKLACRLKRMGVHILRGGAYKPRTSPYSF 74 789****************************************************************** PP TIGR01361 71 qGlgeeglkllkrakdetgllvvtevlderdveivaeyvDilqiGarnmqnfelLkevgkskkPvlLkr 139 qGlg++gl++l+ a +gl+v+te+ d+r++ v +y+Di+qiG+rnmqnfelLkevg+ + PvlLkr lcl|NCBI__GCF_900115975.1:WP_092481604.1 75 QGLGKDGLRILADAGRVAGLPVITELTDVRHLPEVCRYADIIQIGSRNMQNFELLKEVGRVNFPVLLKR 143 ********************************************************************* PP TIGR01361 140 glaatieewleaaeYilsegnenvilcerGirtfekatrftldlsavallkklthlPvivDpshaaGrr 208 gl+at+eewl aaeYil+egn +vilcerGir+fe++tr+t+d++ava++k l+hlP+++Dpsh++Grr lcl|NCBI__GCF_900115975.1:WP_092481604.1 144 GLSATLEEWLLAAEYILAEGNREVILCERGIRGFETYTRNTFDINAVAAVKYLSHLPLVADPSHGTGRR 212 ********************************************************************* PP TIGR01361 209 dlvlplakaavavGadgllievhpdPekalsDseqqltpeefkelvkelk 258 +lvlp+a+aa+a+Gadgl++evhp+Pe+alsD++q+l+pee++ ++++l+ lcl|NCBI__GCF_900115975.1:WP_092481604.1 213 ELVLPVARAALAAGADGLMLEVHPNPENALSDGPQSLRPEELAVFMQDLQ 262 **********************************************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (260 nodes) Target sequences: 1 (273 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.27 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory