Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_092481813.1 BM299_RS02155 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_900115975.1:WP_092481813.1 Length = 512 Score = 275 bits (704), Expect = 3e-78 Identities = 169/428 (39%), Positives = 245/428 (57%), Gaps = 17/428 (3%) Query: 372 KALSRPIQKTS----EIMHLVNPIIENVRDKGNSALLEYTEKFDGVKLSN---PVLNAPF 424 KAL +QK + ++ V II +VR G+ L T +FDG++L+ PV Sbjct: 10 KALDDLLQKRTIDLEKVEDSVKEIINSVRSGGDEQLCTITARFDGIRLAPADLPVSRDEI 69 Query: 425 PEEYFEGLTEEMKEALDLSIENVRKFHAAQLPTETLEVETQPGVLCSRFPRPIEKVGLYI 484 Y + + + AL ++ N+ +H+ QL ++ + G L + P+ +VG+Y+ Sbjct: 70 QAAYGK-VNADFLTALRTAVRNIYHYHSRQLRNSWIDPQPD-GTLLGQLLTPLRRVGIYV 127 Query: 485 PGGTAILPSTALMLGVPAQVAQCKEIVFASPPRKSDGKVSPEVVYVAEKVGASKIVLAGG 544 PGG A PS+ LM +PA VA EIV +PP +S G V+P + A + G ++I AGG Sbjct: 128 PGGKASYPSSVLMNAIPAAVAGVPEIVMVTPPDRS-GSVNPHTLVAAAEAGVTEIYRAGG 186 Query: 545 AQAVAAMAYGTETIPKVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADE 604 AQAVAA+AYGT+TI +VDKI GPGN +VTAAK V IDM AGPSEVL++ADE Sbjct: 187 AQAVAALAYGTQTIARVDKITGPGNIYVTAAKRQVFGTVD----IDMLAGPSEVLIVADE 242 Query: 605 DADVDFVASDLLSQAEHGIDSQVILVGVNLSEKKIQEIQDAVHNQALQLPRVDIVRKCI- 663 A D+VA+D+L+QAEH + ILV + ++Q ++ Q +L R I K I Sbjct: 243 SARPDYVAADMLAQAEHDELASAILV--TPVAELADQVQQELYKQLKKLSRRTIAEKSIN 300 Query: 664 AHSTIVLCDGYEEALEMSNQYAPEHLILQIANANDYVKLVDNAGSVFVGAYTPESCGDYS 723 I+L + +A+E++ +APEHL L +A ++ V+NAG+VF+G Y+PE GDY Sbjct: 301 QRGAIILTENLAQAVEIAASFAPEHLELLLAEPYRWLGSVNNAGAVFLGHYSPEPVGDYI 360 Query: 724 SGTNHTLPTYGYARQYSGANTATFQKFITAQNITPEGLENIGRAVMCVAKKEGLDGHRNA 783 +G NH LPT G AR +S N TF K + TP+ L G+ + +A EGLD H + Sbjct: 361 AGPNHVLPTGGTARFFSPLNVDTFMKKTSLIGYTPQKLARFGKHAVTLACMEGLDAHAAS 420 Query: 784 VKIRMSKL 791 V+ R+ L Sbjct: 421 VQFRLDSL 428 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 790 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 512 Length adjustment: 38 Effective length of query: 761 Effective length of database: 474 Effective search space: 360714 Effective search space used: 360714 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory