Align 3-isopropylmalate dehydrogenase; 3-IPM-DH; IMDH; EC 1.1.1.85; Beta-IPM dehydrogenase (uncharacterized)
to candidate WP_092481825.1 BM299_RS02220 isocitrate dehydrogenase (NAD(+))
Query= curated2:O29627 (326 letters) >NCBI__GCF_900115975.1:WP_092481825.1 Length = 333 Score = 298 bits (763), Expect = 1e-85 Identities = 153/328 (46%), Positives = 221/328 (67%), Gaps = 6/328 (1%) Query: 4 IVVIPGDGIGKEVMEAAMLILEKLDLPFEYSYYDAGDEALEKYGKALPDETLEACRKSDA 63 + +IPGDGIG E+ EAA +++ + + +AG+ +E+YG LP+ L++ +++ Sbjct: 5 VTLIPGDGIGPEISEAARRVIDATGVDINWEVVEAGEAVIERYGTPLPEYVLDSIKENKV 64 Query: 64 VLFGA----AGETAADVIVRLRRELGTFANVRPAKAIEGIECLYPGLDIVVVRENTECLY 119 L G G+ V V LR+ L +AN+RPA+++ GI Y +D++VVRENTE LY Sbjct: 65 ALKGPLTTPVGKGFRSVNVTLRQSLNLYANIRPARSLPGIVTRYRDIDLIVVRENTEDLY 124 Query: 120 MGFEFGFG-DVTEAIRVITREASERIARYAFELAKREGRKKVTALHKANVMKKTCGLFRD 178 G E G D E+I++ITREASER+ R+AFELA+++GRKKVTA+HKAN+MK + GLF + Sbjct: 125 AGIEHRVGRDAAESIKIITREASERVCRHAFELARKQGRKKVTAVHKANIMKLSDGLFLE 184 Query: 179 VCREVAKDYPEIQYNDYYIDAACMYLVMDPFRFDVIVTTNMFGDIVSDLAAGLVGGLGLA 238 R+VA+DYP+I++ D +DA M LV P +DV+V +N++GDI+SDL AGLVGGLG+A Sbjct: 185 SARKVAEDYPDIEFEDMIVDAMSMKLVQTPENYDVMVMSNLYGDILSDLCAGLVGGLGVA 244 Query: 239 PSANVGERTAIFEPVHGAAFDIAGKGIANPTAMILTACMMLRHFGYVEEAKKVEEAVEKT 298 P AN+G A+FEPVHG+A AGK NP A+IL+ MML+H G + A+++ +AV Sbjct: 245 PGANIGTEAAVFEPVHGSAPKHAGKNKVNPLAIILSGVMMLQHLGEDKHAERIMQAVIDV 304 Query: 299 IKEGKK-TPDLGGNLKTMEFANEVASLL 325 ++EG T DLGG T A+ + S L Sbjct: 305 LEEGASVTYDLGGTASTSGMADAIISKL 332 Lambda K H 0.321 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 333 Length adjustment: 28 Effective length of query: 298 Effective length of database: 305 Effective search space: 90890 Effective search space used: 90890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory