Align Probable 2-isopropylmalate synthase; EC 2.3.3.13; Alpha-IPM synthase; Alpha-isopropylmalate synthase (uncharacterized)
to candidate WP_092483014.1 BM299_RS08325 citramalate synthase
Query= curated2:Q8TYB1 (499 letters) >NCBI__GCF_900115975.1:WP_092483014.1 Length = 537 Score = 233 bits (593), Expect = 2e-65 Identities = 159/509 (31%), Positives = 262/509 (51%), Gaps = 22/509 (4%) Query: 4 RVRIFDTTLRDGEQTPGVSLTVEEKVEIARKLDEFGVDTIEAGFPVASEGEFEAVRAIAG 63 +V I+DTTLRDG Q G+S + ++KV+IA +LD+ G IE G+P ++ + I Sbjct: 3 KVEIYDTTLRDGTQGEGISFSAKDKVKIALRLDKLGFHYIEGGWPGSNPKDLRFFELIKE 62 Query: 64 EEL-DAEICGLARCVKGDIDAAIDADV--------DCVHVFIATSDIHLRYKLEMSREEA 114 L +A IC K I + D ++ +F T D H+ Y L + EE Sbjct: 63 HRLKNARICAFGSTRKPGIAPSEDENLMQIVRSAAPVATIFGKTWDFHVEYALLATLEEN 122 Query: 115 LERAIEGVEYASDHGVTVEFSAE---DATRTDRDYLLEVYKATVEAGADRVNVPDTVGVM 171 L+ E V + + + V + AE D + + +Y + +A + GA R+ + DT G Sbjct: 123 LKMIKESVAFLRHNNMEVFYDAEHFFDGYKANPEYAMATLQAARDGGAARIILCDTNGGS 182 Query: 172 TPPEMYRLTAEVVDAVDVPVSVHCHNDFGMAVANSLAAVEAGAEQVHVTVNGIGERAGNA 231 P E++ + ++V +DVP+ +HCHND +AVAN++AAV+AGA QV T+NG GER GNA Sbjct: 183 LPGEIFEMVSQVSRTLDVPLGIHCHNDSELAVANTMAAVQAGAIQVQGTINGYGERCGNA 242 Query: 232 SLEQVV--MALKALYDIELDVRTEMLVELSRLVERLTGVVVPPNTPIVGENAFAHESGIH 289 +L V+ +A K + + ELSR V + + N P VG +AFAH+ G+H Sbjct: 243 NLCSVIPNLAFKCGVASLPEESLAEVTELSRFVSEMANMHPMNNQPYVGGSAFAHKGGVH 302 Query: 290 SHGVIKKAETYEPIRPEDVGHRRRIVLGKHAGRHAIKKKLEE--MGIEVTEEQLDEIVRR 347 ++K TYE I PE VG+RRR+++ + +G + K E +G+ + +E +++ Sbjct: 303 VSALLKNPRTYEHIEPEKVGNRRRVLVSELSGLSNLLYKYRELDLGLGLEKEDNRKVLEE 362 Query: 348 VKELGDKGKRV--TEDDLEAIARDVVGEVPESEAAVKLEEIAVMTGNKFTPTASVRVYLD 405 +KEL ++G + E E R E + L+ + M A +++ ++ Sbjct: 363 LKELENQGYQFEGAEGSFELRLRKAFHGYKEPFSLENLKILIEMRDGTVYSEAIIKMNVN 422 Query: 406 GEEHEAASTGVGSVDAAIRALREAIEELGMDVE---LKEYRLEAITGGTDALAEVTVRLE 462 G+ A+ G G V+A ALR+A+E+ D+ L +Y++ + A V V +E Sbjct: 423 GQVVHTAAEGNGPVNALDNALRKALEDFYPDIAGMYLTDYKVRVLDEKDGTGAVVRVLVE 482 Query: 463 DEDGNVTTAR-GAAEDIVMASVKAFVRGV 490 DG+ + G + +I+ AS +A V + Sbjct: 483 TGDGHCSWGTVGVSSNIIQASWEALVDSI 511 Lambda K H 0.315 0.133 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 532 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 499 Length of database: 537 Length adjustment: 35 Effective length of query: 464 Effective length of database: 502 Effective search space: 232928 Effective search space used: 232928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory