Align glutamine synthetase (EC 6.3.1.2) (characterized)
to candidate WP_092484472.1 BM299_RS11980 type I glutamate--ammonia ligase
Query= BRENDA::Q8PY99 (447 letters) >NCBI__GCF_900115975.1:WP_092484472.1 Length = 439 Score = 517 bits (1331), Expect = e-151 Identities = 248/437 (56%), Positives = 315/437 (72%), Gaps = 5/437 (1%) Query: 8 TTKEDVLEAVKERDVKFIRTQFTDTLGIIKSWAIPAEQLEEAFENGVMFDGSSIQGFTRI 67 T+K+DV + VKE ++FIR QFTD GIIKS +I ++L++AF + FDGSSI GF RI Sbjct: 5 TSKDDVYKLVKENGIEFIRLQFTDIFGIIKSTSIMVDELDKAFAGELFFDGSSIDGFARI 64 Query: 68 EESDMKLALDPSTFRILPWRPATGAVARILGDVYLPDGNPFKGDPRYVLKTAIKEAEKMG 127 EESD + DPSTF+I+PWRP VAR++ DVY PDG PF+G PRY+LK A++EAE+M Sbjct: 65 EESDQVIVPDPSTFKIMPWRPKEEGVARMICDVYAPDGKPFEGCPRYILKKAVREAEEMS 124 Query: 128 FSMNVGPELEFFLFKLDANGNPTTELTDQGGYFDFAPLDRAQDVRRDIDYALEHMGFQIE 187 + +N+GPE EFFLF D G PT ++ D GYFD AP+D +D RR+I L+ MGF+IE Sbjct: 125 YKLNIGPEGEFFLFYTDEKGYPTFDIHDNAGYFDLAPVDMGEDARRNIILTLKKMGFKIE 184 Query: 188 ASHHEVAPSQHEIDFRFGDVLCTADNVVTFKYVVKSIAYHKGYYASFMPKPLFGVNGSGM 247 ASHHEVAP QHEIDF++ + L TADN +TF+ VVK++A YA+FMPKP G NG+ M Sbjct: 185 ASHHEVAPGQHEIDFKYDEALATADNWMTFRDVVKNVAKQFNLYATFMPKPFTGKNGNAM 244 Query: 248 HSNQSLFKDGKNVFYDPDTPTKLSQDAMYYIGGLLKHIREFTAVTNPVVNSYKRLVPGYE 307 H NQSLF +VFYD D LS A+ YIGGLLKH R +TNP+VNSYKRL PGYE Sbjct: 245 HCNQSLFSGDTDVFYDSDKADGLSDIALNYIGGLLKHARGMAPITNPIVNSYKRLKPGYE 304 Query: 308 APVYISWSAQNRSSLIRIPATRGNGTRIELRCPDPACNPYLAFALMLRAGLEGIKNKIDP 367 AP++I+WS NRS+LIRIPA RGN TR+ELR PDP NPYL FA+MLRAGL+GIKN+I P Sbjct: 305 APIHIAWSTSNRSTLIRIPAARGNSTRVELRNPDPTANPYLVFAVMLRAGLDGIKNEISP 364 Query: 368 GEPTNVNIFHLSDKEREERGIRSLPADLKEAIDEMKGSKFVKEALGEHVFSHYLCAKEME 427 P N N++ + ++E I P DL+EAI EMK ++E LG+H++ YL K+ E Sbjct: 365 PAPQNGNMYTMHNEE-----IPLFPRDLQEAIVEMKKDPLIRETLGDHIYERYLDVKQKE 419 Query: 428 WDEYKAVVHPWELSRYL 444 W+EY VH WE++RYL Sbjct: 420 WNEYAETVHNWEINRYL 436 Lambda K H 0.320 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 653 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 447 Length of database: 439 Length adjustment: 32 Effective length of query: 415 Effective length of database: 407 Effective search space: 168905 Effective search space used: 168905 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_092484472.1 BM299_RS11980 (type I glutamate--ammonia ligase)
to HMM TIGR00653 (glnA: glutamine synthetase, type I (EC 6.3.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00653.hmm # target sequence database: /tmp/gapView.30722.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00653 [M=462] Accession: TIGR00653 Description: GlnA: glutamine synthetase, type I Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-165 535.3 0.3 5.7e-163 528.8 0.3 2.0 1 lcl|NCBI__GCF_900115975.1:WP_092484472.1 BM299_RS11980 type I glutamate-- Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900115975.1:WP_092484472.1 BM299_RS11980 type I glutamate--ammonia ligase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 528.8 0.3 5.7e-163 5.7e-163 2 461 .. 9 436 .. 8 437 .. 0.98 Alignments for each domain: == domain 1 score: 528.8 bits; conditional E-value: 5.7e-163 TIGR00653 2 evlkllkeenvkfvdlrfvDikGklkkveipvseleeealeegiaFDgssveGfksieesDlllkpdpe 70 +v kl+ke+ ++f++l+f+Di G++k+ +i v+el+ +a+ + FDgss+ Gf +ieesD +++pdp+ lcl|NCBI__GCF_900115975.1:WP_092484472.1 9 DVYKLVKENGIEFIRLQFTDIFGIIKSTSIMVDELD-KAFAGELFFDGSSIDGFARIEESDQVIVPDPS 76 6889*******************************8.9999**************************** PP TIGR00653 71 tlvivPfraek..vlrvicdvyepvtkepyerdpRsiakraeeelktklgdevyfGpEaEFflfdkvef 137 t++i+P+r ++ v+r+icdvy p +++p+e++pR+i+k+a e +++++++++GpE EFflf ++e+ lcl|NCBI__GCF_900115975.1:WP_092484472.1 77 TFKIMPWRPKEegVARMICDVYAP-DGKPFEGCPRYILKKAVREA-EEMSYKLNIGPEGEFFLFYTDEK 143 ********98889***********.*******************9.5******************9999 PP TIGR00653 138 keasnssflevdseegewnreveegnkgykikkkggYfdvepvDkakdirrelvlaleelglevevsHH 206 + ++ i+++ gYfd++pvD +d rr+++l+l+++g+++e+sHH lcl|NCBI__GCF_900115975.1:WP_092484472.1 144 GYP------------------------TFDIHDNAGYFDLAPVDMGEDARRNIILTLKKMGFKIEASHH 188 844........................7899************************************** PP TIGR00653 207 EvataqaEidikfdklvkaaDeivlyKyvvknvakkhGktatFmpKplfgdngsGmHvhlslwkdgenl 275 Eva++q+Eid+k+d+++ +aD+ ++++ vvknvak+ ++atFmpKp++g+ng+ mH+++sl++ ++ lcl|NCBI__GCF_900115975.1:WP_092484472.1 189 EVAPGQHEIDFKYDEALATADNWMTFRDVVKNVAKQFNLYATFMPKPFTGKNGNAMHCNQSLFSGDTDV 257 ********************************************************************* PP TIGR00653 276 fageegyagLsetalyyigGilkHakalaAltnptvnsYkRLvpGyEAPvylaysaknRsaliRiPasa 344 f+++++ gLs+ al yigG+lkHa+++a +tnp vnsYkRL pGyEAP+ +a+s++nRs+liRiPa++ lcl|NCBI__GCF_900115975.1:WP_092484472.1 258 FYDSDKADGLSDIALNYIGGLLKHARGMAPITNPIVNSYKRLKPGYEAPIHIAWSTSNRSTLIRIPAAR 326 ********************************************************************* PP TIGR00653 345 npkakRiEvRspDpsanpYLafaallmAgldGiknkidpgepldknlyelseeelkelGieqlpesLee 413 ++++R+E+R pDp+anpYL fa++l AgldGikn+i p++p + n+y + +ee i+ p++L+e lcl|NCBI__GCF_900115975.1:WP_092484472.1 327 -GNSTRVELRNPDPTANPYLVFAVMLRAGLDGIKNEISPPAPQNGNMYTMHNEE-----IPLFPRDLQE 389 .*************************************************9886.....788******* PP TIGR00653 414 aldelesdkevlkevlgeelieafielkrkEveelrlkvhpvElekyl 461 a+ e+++d +++e lg++++e+++++k+kE++e+ +vh++E+++yl lcl|NCBI__GCF_900115975.1:WP_092484472.1 390 AIVEMKKD-PLIRETLGDHIYERYLDVKQKEWNEYAETVHNWEINRYL 436 ********.99***********************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (462 nodes) Target sequences: 1 (439 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.04u 0.01s 00:00:00.05 Elapsed: 00:00:00.04 # Mc/sec: 4.55 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory