Align Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 (uncharacterized)
to candidate WP_092484628.1 BM299_RS12230 diaminopimelate decarboxylase
Query= curated2:O27390 (428 letters) >NCBI__GCF_900115975.1:WP_092484628.1 Length = 417 Score = 238 bits (607), Expect = 3e-67 Identities = 138/396 (34%), Positives = 219/396 (55%), Gaps = 4/396 (1%) Query: 21 VELADEYGTPLYVIDEMRIRENYRRLYRAFSGEYSRFQVFYACKANTNLAVMRILEEEGS 80 +++ ++Y TP ++ DE IR+N R L ++F F+ ++A KA N +M+IL+EEG Sbjct: 14 MQIIEQYPTPFHIYDEAAIRKNARNLVQSFDWAPG-FKEYFAVKATPNPYIMKILKEEGF 72 Query: 81 GIDAVSPGEIYTALMAGFDPDRILYTGNNVRDDELQFALDSGVRINVDSRSQLLRLSEIA 140 G D S E+ A AG + I+++ N+ +E Q A + G IN+D S + L + A Sbjct: 73 GADCSSLPELILADKAGIRGEDIMFSSNDTPAEEYQVARELGAIINLDDISHIDYLEKHA 132 Query: 141 PEGLRISFRVNPLVGAGHHEHCITGGEMSKFGVMEREAPEVYRMAMDLGFEPVGIHAHIG 200 ISFR NP I E +K+G+ + + + + G G+H + Sbjct: 133 GIPEVISFRYNPGPLRKGGNAIIGKPEEAKYGLTREQIFQACEIMRNKGVGRFGLHTMVI 192 Query: 201 SGILDPEPFMLAVETLMDIAGRVHEATGVEFEFIDFGGGLGIPYTPEEEPLDIDEFASKI 260 S LDP F+ + D+A +++ + EF++ GGG+GIPY P EEP+D+ + I Sbjct: 193 SNELDPTYFIETANMMFDLAVEIYQKLNIRVEFVNLGGGIGIPYLPHEEPVDLHYVSQGI 252 Query: 261 TGLFKDKLSEYGLGRPMMCLEPGRYIVGDASYLLTRVNTIKESYRKFAGVDAGFNTLLRP 320 ++ K++ GL + +E GR I G YL+ V KE Y+ + G+DA L+RP Sbjct: 253 KDAYEKKITPNGLHPLKLAMESGRMITGPYGYLVATVLHKKEIYKNYVGLDACMANLMRP 312 Query: 321 AMYGSYHHILVAERPLDEPSEKM-DVAGNVCESGDLFARDRQLPEINEGDVLAIMNAGAY 379 +YG+YHHI V + D P + + DV G++CE+ D FA DR+LPEI GD+L I + GA+ Sbjct: 313 GIYGAYHHITVVGKE-DWPHDHIYDVTGSLCENNDKFAIDRKLPEIEIGDILVIHDTGAH 371 Query: 380 SFSMSSQYNSRPRPAEVLVR-EGKVDVVRERETFSD 414 +M YN + R AE+L++ +G V+++R ET D Sbjct: 372 GHAMGFNYNGKLRSAELLLKPDGTVEMIRRAETIDD 407 Lambda K H 0.320 0.140 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 479 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 428 Length of database: 417 Length adjustment: 32 Effective length of query: 396 Effective length of database: 385 Effective search space: 152460 Effective search space used: 152460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory