Align Aminodeoxychorismate/anthranilate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85; EC 4.1.3.27 (characterized)
to candidate WP_092485904.1 BM299_RS14590 aminodeoxychorismate/anthranilate synthase component II
Query= SwissProt::P28819 (194 letters) >NCBI__GCF_900115975.1:WP_092485904.1 Length = 196 Score = 262 bits (669), Expect = 3e-75 Identities = 122/190 (64%), Positives = 150/190 (78%) Query: 1 MILMIDNYDSFTYNLVQYLGELGEELVVKRNDSITIDEIEELSPDFLMISPGPCSPDEAG 60 MIL+IDNYDSF +NL QYL ELG E+VV RND IT+ EI E+ P+ +++SPGPC+PDEAG Sbjct: 1 MILLIDNYDSFVFNLYQYLSELGREVVVHRNDRITVTEITEMEPECIVLSPGPCTPDEAG 60 Query: 61 ISLEAIKHFAGKIPIFGVCLGHQSIAQVFGGDVVRAERLMHGKTSDIEHDGKTIFEGLKN 120 ISLEA++ AG PIFGVCLGHQ+I Q FGG VVRA+RLMHGKTS I HDGK+I+ GL N Sbjct: 61 ISLEAVRRLAGVFPIFGVCLGHQTIGQAFGGKVVRAKRLMHGKTSRIFHDGKSIYTGLPN 120 Query: 121 PLVATRYHSLIVKPETLPSCFTVTAQTKEGEIMAIRHNDLPIEGVQFHPESIMTSFGKEM 180 PL RYHSLI++ E LP C VTA+T GEIM +RH L +EGVQFHPESI+T GK+M Sbjct: 121 PLQVARYHSLILEQEALPGCLEVTARTARGEIMGVRHRHLAVEGVQFHPESILTVHGKKM 180 Query: 181 LRNFIETYRK 190 L N+++ ++ Sbjct: 181 LTNYLQIIQR 190 Lambda K H 0.320 0.139 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 194 Length of database: 196 Length adjustment: 20 Effective length of query: 174 Effective length of database: 176 Effective search space: 30624 Effective search space used: 30624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
Align candidate WP_092485904.1 BM299_RS14590 (aminodeoxychorismate/anthranilate synthase component II)
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00566.hmm # target sequence database: /tmp/gapView.18746.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00566 [M=192] Accession: TIGR00566 Description: trpG_papA: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-83 263.0 0.0 8.7e-83 262.9 0.0 1.0 1 lcl|NCBI__GCF_900115975.1:WP_092485904.1 BM299_RS14590 aminodeoxychorisma Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900115975.1:WP_092485904.1 BM299_RS14590 aminodeoxychorismate/anthranilate synthase component II # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 262.9 0.0 8.7e-83 8.7e-83 1 191 [. 1 186 [. 1 187 [. 0.99 Alignments for each domain: == domain 1 score: 262.9 bits; conditional E-value: 8.7e-83 TIGR00566 1 mvllidnydsftynlvqlleelgaevvvkrndsltlqeieallpllsivisPGPctPdeaaisslelie 69 m+llidnydsf +nl+q+l+elg evvv+rnd +t++ei ++ p+ iv+sPGPctPdea+is le+++ lcl|NCBI__GCF_900115975.1:WP_092485904.1 1 MILLIDNYDSFVFNLYQYLSELGREVVVHRNDRITVTEITEMEPEC-IVLSPGPCTPDEAGIS-LEAVR 67 79*******************************************9.****************.***** PP TIGR00566 70 hlaGklPilGvClGhqalaqafGadvvraekvkhGkvseiehngaavfaglfnPdalkatryhslvvea 138 +laG +Pi+GvClGhq+++qafG++vvra++++hGk+s i h+g+++++gl nP l+++ryhsl++e lcl|NCBI__GCF_900115975.1:WP_092485904.1 68 RLAGVFPIFGVCLGHQTIGQAFGGKVVRAKRLMHGKTSRIFHDGKSIYTGLPNP--LQVARYHSLILEQ 134 ******************************************************..************* PP TIGR00566 139 etldtllevtaleeeeieimairhrdlpleGvqfhPesilselGkellanflk 191 e+l+ +levta + + eim++rhr+l++eGvqfhPesil+ +Gk++l+n+l+ lcl|NCBI__GCF_900115975.1:WP_092485904.1 135 EALPGCLEVTARTARG-EIMGVRHRHLAVEGVQFHPESILTVHGKKMLTNYLQ 186 *************999.**********************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (192 nodes) Target sequences: 1 (196 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.89 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory