Align 2-isopropylmalate synthase 2; EC 2.3.3.13; Alpha-IPM synthase 2; Alpha-isopropylmalate synthase 2 (uncharacterized)
to candidate WP_092487040.1 BM299_RS16585 homocitrate synthase
Query= curated2:Q8RCF9 (384 letters) >NCBI__GCF_900115975.1:WP_092487040.1 Length = 300 Score = 259 bits (662), Expect = 7e-74 Identities = 132/263 (50%), Positives = 175/263 (66%) Query: 11 IVDTTLRDGEQTAGVVFANNEKIRIAQMLDEIGIDQLEVGIPTMGGDEKETVAKIAKLGL 70 IVDTTLRDGEQ GV F EK+ IA+MLD +G++ +E GIP MG E+ET+ I LGL Sbjct: 15 IVDTTLRDGEQAPGVAFTLKEKVTIARMLDLLGVEVIEAGIPVMGEIEQETLRAICSLGL 74 Query: 71 KASIMAWNRAVVKDVQESLECGVDAVAISISTSDIHIEHKLKKTRQWVLDSMTEAVRFAK 130 +A + +WNR ++ D++ S+ CGV + IS SD+HI KL K+RQWVLD + AVR+A+ Sbjct: 75 RARVASWNRLLLADIRVSIACGVRDLHISAPVSDLHITKKLGKSRQWVLDCLVRAVRYAR 134 Query: 131 KEGVYVSVNAEDASRTDMNFLIEFARCAKQAGADRLRFCDTVGFLDPFKTYEMVKAIKDA 190 G VSV AEDASR D NFL+EFA A++AG +RLR+ DTVG L+PF T V + Sbjct: 135 DYGCRVSVGAEDASRADFNFLLEFALLAQEAGVERLRYADTVGILEPFATRRQVGLLVSN 194 Query: 191 VDIEIEMHTHNDFGMATANALAGVKAGAKFVGVTVNGLGERAGNAALEEVVMALKYVYKM 250 + I +E H HNDFG+ATAN+LA AGA ++ TV GLGERAGNA+LE+++ + Sbjct: 195 LSIPVEFHGHNDFGLATANSLAAFGAGAAYISTTVGGLGERAGNASLEDMLGLFWSGFHS 254 Query: 251 DLGIDTSRFREISEYVALASGRP 273 + +S YVA A+ RP Sbjct: 255 PGRFKSRVLESLSRYVARAASRP 277 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 300 Length adjustment: 28 Effective length of query: 356 Effective length of database: 272 Effective search space: 96832 Effective search space used: 96832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory