Align Aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.79 (characterized)
to candidate WP_092991489.1 BLP65_RS00370 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::Q82WA8 (397 letters) >NCBI__GCF_900102855.1:WP_092991489.1 Length = 395 Score = 521 bits (1342), Expect = e-152 Identities = 256/396 (64%), Positives = 320/396 (80%), Gaps = 6/396 (1%) Query: 1 MKLSQRVQAIKPSPTLAVTAKAARLKAEGKNIIGLGAGEPDFDTPLHIKDAAITAIRNGF 60 ++LS RVQ +KPSPTLAVTA+A LKA+GK+IIGLGAGEPDFDTP HIK+AAI AIR+GF Sbjct: 3 IQLSHRVQKVKPSPTLAVTARAKELKAQGKDIIGLGAGEPDFDTPEHIKEAAIAAIRDGF 62 Query: 61 TKYTAVGGTASLKQAIISKFKRENSLEFMPGEILVSSGGKQSFFNLVLATIDPGDEVIIP 120 TKYTAV GT LK A+I KF+R+N+LE+ P +ILVSSGGKQSF+N+ A ++ GDE II Sbjct: 63 TKYTAVDGTPGLKDAVIEKFRRDNALEYQPAQILVSSGGKQSFYNMAQALLNSGDEAIIA 122 Query: 121 APYWVSYPDIVLIAEGKPVFIDTGIEEKFKISPDQLEKAITPRTRMFVVNSPSNPSGSVY 180 APYWVSYPD+VL+A+GKPV I+ GIE+ FKI+P+QL+ AITP+TR+ V+NSPSNP+G Y Sbjct: 123 APYWVSYPDMVLLADGKPVVIEAGIEQGFKITPEQLQAAITPQTRLVVLNSPSNPTGVAY 182 Query: 181 SLEELQALGAVLRKYPDILIATDDMYEHILLSGDGFVNILNACPDLKARTVVLNGVSKAY 240 + EL ALG VLR++P I+IA+DDMYEHIL + + F NI+NACP+L RTVV+NGVSKAY Sbjct: 183 TRAELAALGEVLRQHPKIVIASDDMYEHILWADEPFCNIVNACPELYERTVVMNGVSKAY 242 Query: 241 AMTGWRIGYCGGPAAIITAMENIQSQSTSNPNSIAQVAAEAALNGDQSCMVPMIEAFRER 300 +MTGWRIGY GGP +I +M+ IQSQSTSNP SI+Q AAEAAL GDQSC+ M++AF+ER Sbjct: 243 SMTGWRIGYAGGPEKLIQSMKKIQSQSTSNPASISQAAAEAALRGDQSCIQEMLKAFKER 302 Query: 301 NQFLTNALNSIAGIHCLLSEGAFYAFVDVRQAISRLNTQQILQNSSDIAFCNYVLEKAEV 360 + F+ LN I G+HCL S+GAFY+F D+ AI T+ +D+ F Y+L +AEV Sbjct: 303 HDFVVQRLNRIKGVHCLASQGAFYSFPDMSSAIDATGTE------NDVQFAEYLLNEAEV 356 Query: 361 AAVPGSAFGCEGYMRLSFATSMDNLQEAVKRIASLL 396 A VPGSAFG GYMRLSFATS+DNL+EA+ R+A LL Sbjct: 357 ALVPGSAFGKPGYMRLSFATSLDNLREALDRLARLL 392 Lambda K H 0.318 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 395 Length adjustment: 31 Effective length of query: 366 Effective length of database: 364 Effective search space: 133224 Effective search space used: 133224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory