Align Acetylglutamate kinase; EC 2.7.2.8; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK (uncharacterized)
to candidate WP_092992187.1 BLP65_RS02360 amino-acid N-acetyltransferase
Query= curated2:O67848 (298 letters) >NCBI__GCF_900102855.1:WP_092992187.1 Length = 442 Score = 146 bits (368), Expect = 1e-39 Identities = 93/288 (32%), Positives = 154/288 (53%), Gaps = 12/288 (4%) Query: 12 QEALPYIREFHGKVFVIKYGGSAMHDEELRESFARDVVLLKYVGINPVIVHGGGPQISKT 71 + + PYI F G+ FV+ +GG + +++ S D+ LL +G+ V+VHG PQI + Sbjct: 17 RNSAPYINAFRGRTFVVAFGGEVVAEKQFA-SLVHDIALLNSLGVRLVLVHGARPQIEER 75 Query: 72 LEKFGIKPKFVGGMRKTDEETMHVVEMVLSGDINKDIVALINRYSGEKIYAVGLSGRDGR 131 L + G K K+V G+R TDE+ + V+ +G + +I AL++ ++G + R Sbjct: 76 LRERGAKMKYVNGLRVTDEQALACVKEA-TGTVRVEIEALLSMGLANS----PMAGAEIR 130 Query: 132 LLKAKKLDKERYFSELGLPVPEEDIGFVGEIVDVNEELIFTLLSHNFIPVIAPVGVGEEG 191 + + + G+ D GE+ + E + L I +++P+G G Sbjct: 131 VASGNFVTAQPLGIRNGV-----DYLHTGEVRRIAESAVRKQLDDGAIVLLSPLGYSPTG 185 Query: 192 EAYNVNADLAASEIAGEIKAEKLIYLTDTKGVLDEKGELISSLSKDKAEELIK-KGVIRE 250 E +N++A+ A+ A E+ A KLIYL D G+ D+ G L+ +S D+A E G I E Sbjct: 186 EIFNLSAEDVATAAAVELGASKLIYLVDGPGLTDKDGNLVREISLDEAAEWFDGHGDIPE 245 Query: 251 GMIPKVRSALRALEKGVKKVHIIDGRVKHSILLEVFTKEGVGTEITLE 298 G+ + SA A +GV++ H+ID S+LLE+FT++GVGT +T E Sbjct: 246 GIAKCLFSAQFAGSEGVRRAHLIDRHQDGSLLLELFTRDGVGTLVTAE 293 Lambda K H 0.316 0.139 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 442 Length adjustment: 29 Effective length of query: 269 Effective length of database: 413 Effective search space: 111097 Effective search space used: 111097 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory