Align Prephenate dehydrogenase protein; EC 1.3.1.12 (characterized, see rationale)
to candidate WP_092992268.1 BLP65_RS00415 prephenate dehydrogenase/arogenate dehydrogenase family protein
Query= uniprot:D8IR44_HERSS (295 letters) >NCBI__GCF_900102855.1:WP_092992268.1 Length = 290 Score = 273 bits (699), Expect = 3e-78 Identities = 143/281 (50%), Positives = 185/281 (65%), Gaps = 1/281 (0%) Query: 1 MFKKVVIFGVGLIGGSFALALRRAGQAAHIVGVGRSLQSLERARELGIIDAVATDAASAV 60 M +++ I GVGLIGGS A ALR AG IVG GR L RA ELGIID +TD A AV Sbjct: 1 MVRRLAIIGVGLIGGSLARALRVAGGVGEIVGCGRDEGQLVRAVELGIIDRYSTDPAEAV 60 Query: 61 QGADLILVAAPVAQTGPILASIAPHLEPQAIVTDAGSTKSDVVAAARMALGDRIVQ-FIP 119 GAD +++ PV IL +I PHL AI+TD GSTK VVAAA G R F+P Sbjct: 61 GGADGVVIGTPVGAMESILEAIRPHLADGAIITDVGSTKGSVVAAAHRVFGSRCPPGFVP 120 Query: 120 AHPIAGREKHGPEAALAELYEGKKVVITALPENDAADVEIVAAAWRACGAVIHRLSPQEH 179 HPIAG E++G EA+ AEL++ ++V++T LPE+DA V A W GAV+ ++PQ H Sbjct: 121 GHPIAGTERNGVEASFAELFQRRRVILTPLPESDAGATAAVRAMWEKTGAVVETMTPQHH 180 Query: 180 DAVFASVSHLPHVLAFALVDDIAAKPHAATLFQYAASGFRDFTRIAASSPEMWRDITLAN 239 D VFA+ SHLPH+LA++LV+ +A +F+YAA GFRDFTRIA+S+P MW DI+LAN Sbjct: 181 DEVFAATSHLPHLLAYSLVNTLATLDEKVEIFRYAAGGFRDFTRIASSNPRMWHDISLAN 240 Query: 240 RDALLTEVDAYLLQLQNIRAMIAAGDGPGIEKIYASAQHAR 280 RDALL +D + L +R I AGDG + +++ A+ AR Sbjct: 241 RDALLKVMDRFEGDLHQMRQAIEAGDGDYLLEVFTRAKEAR 281 Lambda K H 0.320 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 290 Length adjustment: 26 Effective length of query: 269 Effective length of database: 264 Effective search space: 71016 Effective search space used: 71016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory