Align Histidinol-phosphate aminotransferase; EC 2.6.1.9 (characterized, see rationale)
to candidate WP_092992325.1 BLP65_RS02175 histidinol-phosphate transaminase
Query= uniprot:A0A975E8Y9 (377 letters) >NCBI__GCF_900102855.1:WP_092992325.1 Length = 359 Score = 303 bits (777), Expect = 4e-87 Identities = 175/368 (47%), Positives = 232/368 (63%), Gaps = 16/368 (4%) Query: 12 LIQRRIRQDVLSMHAYAIQDSVGMVKLDAMENPHRLPAALQEALGKRLGALALNRYPDGR 71 LI + IR ++ +++AY + D ++KLDAMENP+ LP L E L + LNRYPD + Sbjct: 5 LIDKWIRPEIRAINAYPVPDPGRLIKLDAMENPYTLPPELLEEWLDALRDVPLNRYPDAK 64 Query: 72 VNDLRRALAAYAQMPEGFDIMLGNGSDELISLLAMACDVPTDPVTGKRPVILAPLPGFVM 131 L L A +P G D++LGNGSDE+I +LA+A + G +LAP PGFVM Sbjct: 65 ARHLTDRLRATMDVPAGMDLLLGNGSDEIIQMLALA-------LGGPGRTVLAPEPGFVM 117 Query: 132 YAMSAALQGLDFVGVPLTA-DFELDEAAMLAAIAQHQPAIVYLAYPNNPTANLWNAESMA 190 Y M A G+D+VGVPL DF L+ AML I QHQPAIVYLAYPNNPT NL++ E M Sbjct: 118 YRMIATFTGMDYVGVPLQEEDFGLNRDAMLKGIDQHQPAIVYLAYPNNPTGNLFDPEDMV 177 Query: 191 RVIAATGAVGGLVVLDEAYQPFSSRTYLDTIRSNPAAHAHVLLMRTMSKFGLAGVRIGYM 250 +I A GLVV+DEAY F+ ++++ + ++L+MRT+SK GLAG+R+G++ Sbjct: 178 AIIEAAP---GLVVVDEAYHAFAEQSFMGRL----GEWDNLLVMRTVSKLGLAGLRLGFL 230 Query: 251 VGPKPLIAQVDKVRPPYNISVLNYECALFALEHADVFAGQAADLRAQRTRLLTALRAMPA 310 GP+ I ++DKVR PYNI+VL FAL H V Q A +R +R RL +AL + Sbjct: 231 AGPREWIGELDKVRLPYNINVLTQVSGEFALSHMGVLDEQTARIREERGRLASALGGIEG 290 Query: 311 VKAWDSDANMILVRMA-DAQKTFDGLKARGVLVKNVSKMHPLLAQCLRLTVGTADENTRL 369 V S AN IL R+A DA F GL+ARGVL+KN++ L+ CLR+TVGT +EN Sbjct: 291 VTPCPSAANFILFRVADDADAVFAGLQARGVLIKNLNPAGGALSGCLRVTVGTPEENEAF 350 Query: 370 LAALLESL 377 LAAL ESL Sbjct: 351 LAALRESL 358 Lambda K H 0.322 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 14 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 359 Length adjustment: 30 Effective length of query: 347 Effective length of database: 329 Effective search space: 114163 Effective search space used: 114163 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate WP_092992325.1 BLP65_RS02175 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.28583.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-100 321.6 0.0 2.9e-100 321.5 0.0 1.0 1 lcl|NCBI__GCF_900102855.1:WP_092992325.1 BLP65_RS02175 histidinol-phospha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900102855.1:WP_092992325.1 BLP65_RS02175 histidinol-phosphate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 321.5 0.0 2.9e-100 2.9e-100 1 348 [. 11 356 .. 11 357 .. 0.96 Alignments for each domain: == domain 1 score: 321.5 bits; conditional E-value: 2.9e-100 TIGR01141 1 rekikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelk..klhrYpdpqalelkealaky 67 r++i+++++Y + +++ +kL+++EnP+ +++++e++ ++l+ +l+rYpd++a +l+ +l++ lcl|NCBI__GCF_900102855.1:WP_092992325.1 11 RPEIRAINAYPVP---DPG-RLIKLDAMENPYTLPPELLEEWLDALRdvPLNRYPDAKARHLTDRLRAT 75 6789999999884...444.59*************************999******************* PP TIGR01141 68 lgvee.enillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplked.gqedle 134 ++v + ++llgnGsde+i++l+ a+ pg++vl++ep + mY+++a+++g++++ vpl+e+ + + + lcl|NCBI__GCF_900102855.1:WP_092992325.1 76 MDVPAgMDLLLGNGSDEIIQMLALALGGPGRTVLAPEPGFVMYRMIATFTGMDYVGVPLQEEdFGLNRD 144 **765279*****************************************************98667777 PP TIGR01141 135 avle.aakekvklvflasPnnPtGnllkreeiekvleevedalVVvDeAYieFseeasvlellaeypnl 202 a+l+ + ++++ +v+la+PnnPtGnl++ e++++++e++ +lVVvDeAY F+e+ s++ l e++nl lcl|NCBI__GCF_900102855.1:WP_092992325.1 145 AMLKgIDQHQPAIVYLAYPNNPTGNLFDPEDMVAIIEAA-PGLVVVDEAYHAFAEQ-SFMGRLGEWDNL 211 77777999******************************8.9**************7.************ PP TIGR01141 203 vvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkere 271 +v+rT+SK+ LAglR+G++ + e+i +l+kvr pyn+++l++ + al++ + ++++++++er lcl|NCBI__GCF_900102855.1:WP_092992325.1 212 LVMRTVSKLG-LAGLRLGFLAGPREWIGELDKVRLPYNINVLTQVSGEFALSHMGVLDEQTARIREERG 279 ********86.********************************************************** PP TIGR01141 272 rlleelkkleglevyeSkaNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvGtreene 340 rl ++l +eg+ ++S aNF+l++v da++++ l +g+++++l+ a g l++clR+tvGt+eene lcl|NCBI__GCF_900102855.1:WP_092992325.1 280 RLASALGGIEGVTPCPSAANFILFRVADDADAVFAGLQARGVLIKNLNPAGGALSGCLRVTVGTPEENE 348 ********************************************************************* PP TIGR01141 341 rllealke 348 ++l+al+e lcl|NCBI__GCF_900102855.1:WP_092992325.1 349 AFLAALRE 356 ******98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (359 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.62 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory