Align Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic; AGPR; N-acetyl-glutamate semialdehyde dehydrogenase; NAGSA dehydrogenase; EC 1.2.1.38 (characterized)
to candidate WP_093392448.1 BM091_RS00090 N-acetyl-gamma-glutamyl-phosphate reductase
Query= SwissProt::Q93Z70 (401 letters) >NCBI__GCF_900114975.1:WP_093392448.1 Length = 346 Score = 310 bits (793), Expect = 5e-89 Identities = 161/346 (46%), Positives = 227/346 (65%), Gaps = 4/346 (1%) Query: 59 IRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVK 118 +++G+LG SGYTG E++RLLA HP ++ +++ + ++ +P R V Sbjct: 2 LKVGVLGGSGYTGFELIRLLATHPEVKIVAVSSRAQEESAVSEHYPAFRKFVDLRYVLPD 61 Query: 119 DADFST-VDAVFCCLPHGTTQEIIKEL-PTALKIVDLSADFRLRNIAEYEEWYGQPHKAV 176 D F VD VF LPHG + + + L ++++DLSADFR+R+ A YE+WY +PH + Sbjct: 62 DPVFEKGVDVVFSALPHGASMKAVSGLVEKGVRVIDLSADFRIRDAAVYEQWY-EPHTSP 120 Query: 177 ELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGV 236 +L K+ VYGL E+ R +I ARLVANPGCYPT+I L L PLLK LI+ ++IIID+KSGV Sbjct: 121 DLLKDAVYGLPELYRREIASARLVANPGCYPTSIILALAPLLKNRLIEEDSIIIDSKSGV 180 Query: 237 SGAGRGAKEANLYSEIAEGISSYGVTR-HRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIR 295 +GAGRG + E+ EG +Y V HRH+PEIEQ LS ++ ++ V+FTPHL+PM R Sbjct: 181 TGAGRGLSLTTHFCEVNEGFKAYKVGGVHRHIPEIEQELSLISGKEIRVTFTPHLVPMSR 240 Query: 296 GMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPD 355 G+ ST+YV GV+ ++ + +T Y DE FV+++ G +P T VRGSN+C + D Sbjct: 241 GILSTLYVVPREGVKAGEIDEAYRTMYADEPFVRLVGSGEMPSTLQVRGSNFCDIGWKLD 300 Query: 356 RIPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 401 GR I++S IDNL +GASGQA+ N+NIM G PETTGL + P P Sbjct: 301 GRSGRLIVVSAIDNLTRGASGQAVCNMNIMFGIPETTGLFYVPWQP 346 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 346 Length adjustment: 30 Effective length of query: 371 Effective length of database: 316 Effective search space: 117236 Effective search space used: 117236 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_093392448.1 BM091_RS00090 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.7059.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-138 445.4 0.0 8.5e-138 445.2 0.0 1.0 1 lcl|NCBI__GCF_900114975.1:WP_093392448.1 BM091_RS00090 N-acetyl-gamma-glu Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900114975.1:WP_093392448.1 BM091_RS00090 N-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 445.2 0.0 8.5e-138 8.5e-138 2 345 .] 3 346 .] 2 346 .] 0.98 Alignments for each domain: == domain 1 score: 445.2 bits; conditional E-value: 8.5e-138 TIGR01850 2 kvaivGasGYtGaeLlrllakHpevevtklvssreagkklsevhphlkglvdlkleeleeeeileeadv 70 kv+++G+sGYtG eL+rlla+Hpev+++++ s+ ++++ +se++p ++++vdl++ ++ +++ +dv lcl|NCBI__GCF_900114975.1:WP_093392448.1 3 KVGVLGGSGYTGFELIRLLATHPEVKIVAVSSRAQEESAVSEHYPAFRKFVDLRYVLPDDPVFEKGVDV 71 8***************************6666666*****************999999998899***** PP TIGR01850 71 vflAlphgvsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelleeavYGlpElnreeik 139 vf Alphg+s++ v+ l+ekgv+vidlSadfR++da+vYe+wY+ h++++ll++avYGlpEl+r+ei+ lcl|NCBI__GCF_900114975.1:WP_093392448.1 72 VFSALPHGASMKAVSGLVEKGVRVIDLSADFRIRDAAVYEQWYEP-HTSPDLLKDAVYGLPELYRREIA 139 *******************************************87.9999******************* PP TIGR01850 140 kaklianPGCyaTaalLalaPllkekliepksiivdaksGvSgAGrkasekslfaevnenlkpYkvt.k 207 +a+l+anPGCy+T+++LalaPllk++lie++sii+d+ksGv+gAGr s +++f+evne +k+Ykv lcl|NCBI__GCF_900114975.1:WP_093392448.1 140 SARLVANPGCYPTSIILALAPLLKNRLIEEDSIIIDSKSGVTGAGRGLSLTTHFCEVNEGFKAYKVGgV 208 ******************************************************************989 PP TIGR01850 208 HrHtpEieqelsklaekkvkvsftphlvpmtrGilatiyaklkkelteeelrklyeevYedepfvrvlk 276 HrH+pEieqels +++k+++v+ftphlvpm+rGil+t+y+ ++++++ e+ ++y+++Y+depfvr++ lcl|NCBI__GCF_900114975.1:WP_093392448.1 209 HRHIPEIEQELSLISGKEIRVTFTPHLVPMSRGILSTLYVVPREGVKAGEIDEAYRTMYADEPFVRLVG 277 ********************************************************************* PP TIGR01850 277 egelPstkavlgsnfvdigvavdeetkrvvvvsaiDNLvKGaagqAvqnlNlmlgfdetegLeklpllp 345 +ge+Pst +v+gsnf+dig+++d +++r++vvsaiDNL++Ga+gqAv n+N+m+g +et+gL ++p p lcl|NCBI__GCF_900114975.1:WP_093392448.1 278 SGEMPSTLQVRGSNFCDIGWKLDGRSGRLIVVSAIDNLTRGASGQAVCNMNIMFGIPETTGLFYVPWQP 346 **************************************************************9999876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (346 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.15 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory