Align Histidinol-phosphatase; HolPase; EC 3.1.3.15; Histidinol-phosphate phosphatase (uncharacterized)
to candidate WP_093395774.1 BM091_RS10925 inositol monophosphatase
Query= curated2:P56160 (259 letters) >NCBI__GCF_900114975.1:WP_093395774.1 Length = 287 Score = 94.0 bits (232), Expect = 3e-24 Identities = 76/249 (30%), Positives = 114/249 (45%), Gaps = 22/249 (8%) Query: 14 KAGKLTLDYFGRRSLQVFSKRDDTPVTEADRNAEELIRQGISAKFPDDGLFGEEFDEHPS 73 KAG+L + ++ K VTE DRN+E LIR+ +++++PDD + GEE S Sbjct: 22 KAGELIKKAYLSQTSSFHHKDKFDYVTETDRNSESLIRKMLNSRYPDDMVIGEETF---S 78 Query: 74 GNGRR----WIIDPIDGTRSFIHGVPLYGVMIALEVEGAMQLGVINFPALGELYQAERGS 129 G G WI+DP+DGT +FIH P V IA + G I EL+ A +G+ Sbjct: 79 GQGLPPEPCWIVDPLDGTTNFIHRFPHISVTIARWDGKDLVAGCIYDVLRNELFTAVKGN 138 Query: 130 GAFMNGSPVQV--------SAIAENSASTVVFTEKEYLLD-PPSNHPVDQLRIDAGLVRG 180 G ++NGSPV + S +A ++YL H V +R R Sbjct: 139 GVYLNGSPVVLPPKNDVLHSLVATGFPFKRKDIARQYLASFQEIFHHVSDIR------RA 192 Query: 181 WGDCYGHMLVASGRAEVAVDKIMSPWDCAAVIPIVEEAGGCCFDYRGRQSIIDGEGLVSA 240 VA GR + + + PWD AA + ++ E GG D+ G ++ +V+A Sbjct: 193 GSAALDLAYVAVGRLDGFWEVGLKPWDIAAGVLMIREMGGIVTDFWGTPEVLQSGHVVAA 252 Query: 241 NNAMGRNLI 249 +LI Sbjct: 253 RTPELHSLI 261 Lambda K H 0.319 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 287 Length adjustment: 25 Effective length of query: 234 Effective length of database: 262 Effective search space: 61308 Effective search space used: 61308 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory