GapMind for Amino acid biosynthesis

 

Alignments for a candidate for gatC in Thermodesulforhabdus norvegica DSM 9990

Align glutamyl-tRNAGln amidotransferase subunit C (EC 6.3.5.7) (characterized)
to candidate WP_093396112.1 BM091_RS12115 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC

Query= metacyc::MONOMER-13957
         (96 letters)



>NCBI__GCF_900114975.1:WP_093396112.1
          Length = 97

 Score = 76.6 bits (187), Expect = 6e-20
 Identities = 34/81 (41%), Positives = 56/81 (69%)

Query: 2  SRISIEEVKHVAHLARLAITEEEAKMFTEQLDSIISFAEELNEVNTDNVEPTTHVLKMKN 61
          ++I++EEV+++A LAR+++ ++E      +L +I+ + E+LNE++T+ VEP  H L+  N
Sbjct: 4  AKITVEEVRNIARLARISLDKDEEGSMVSELGTILDYVEKLNEISTEGVEPLHHPLERSN 63

Query: 62 VMREDEAGKGLPVEDVMKNAP 82
          V REDE G  L  ED + NAP
Sbjct: 64 VYREDEYGNPLKREDALANAP 84


Lambda     K      H
   0.312    0.130    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 38
Number of extensions: 1
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 96
Length of database: 97
Length adjustment: 10
Effective length of query: 86
Effective length of database: 87
Effective search space:     7482
Effective search space used:     7482
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.5 bits)
S2: 39 (19.6 bits)

Align candidate WP_093396112.1 BM091_RS12115 (Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC)
to HMM TIGR00135 (gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit (EC 6.3.5.-))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00135.hmm
# target sequence database:        /tmp/gapView.15690.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00135  [M=93]
Accession:   TIGR00135
Description: gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
    2.9e-29   87.5   0.0    3.2e-29   87.4   0.0    1.0  1  lcl|NCBI__GCF_900114975.1:WP_093396112.1  BM091_RS12115 Asp-tRNA(Asn)/Glu-


Domain annotation for each sequence (and alignments):
>> lcl|NCBI__GCF_900114975.1:WP_093396112.1  BM091_RS12115 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   87.4   0.0   3.2e-29   3.2e-29       1      92 [.       6      97 .]       6      97 .] 0.97

  Alignments for each domain:
  == domain 1  score: 87.4 bits;  conditional E-value: 3.2e-29
                                 TIGR00135  1 iskeevkrlakLarlelseeeaekfaeeLkeilklveqlsevdtenvepmanplelsnklReDeveeslkr 71
                                              i+ eev+++a+Lar++l+++e+ ++++eL +il++ve+l+e+ te+vep+ +ple sn+ ReDe +++lkr
  lcl|NCBI__GCF_900114975.1:WP_093396112.1  6 ITVEEVRNIARLARISLDKDEEGSMVSELGTILDYVEKLNEISTEGVEPLHHPLERSNVYREDEYGNPLKR 76
                                              6779******************************************************************* PP

                                 TIGR00135 72 keilknapekedgfikvPkil 92
                                              +++l+nap+++  f+ v +++
  lcl|NCBI__GCF_900114975.1:WP_093396112.1 77 EDALANAPRTDGVFFIVSRVI 97
                                              ***************998775 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (93 nodes)
Target sequences:                          1  (97 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 3.90
//
[ok]

This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory