Align Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 (characterized)
to candidate WP_123809407.1 BTUS_RS07045 diaminopimelate epimerase
Query= SwissProt::Q81XR2 (288 letters) >NCBI__GCF_000092905.1:WP_123809407.1 Length = 272 Score = 242 bits (618), Expect = 6e-69 Identities = 135/273 (49%), Positives = 168/273 (61%), Gaps = 8/273 (2%) Query: 9 MHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPVKMRMFNN 68 MHGLGN +I V E D +A + + GIGADG++ + PSD A V+MR+FN Sbjct: 1 MHGLGNDFIVV---EGHALPLDPGALARNWCDRHFGIGADGLVFVLPSDRADVQMRIFNA 57 Query: 69 DGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVTLAKIDMGAP 128 DGSE + CGN +RCV KYA+E LV +ETLAG+ + +V +DMG P Sbjct: 58 DGSEAEQCGNAVRCVGKYAFERGLVRRRDLVVETLAGVQRIVLGGNGSRVEEVTVDMGEP 117 Query: 129 RLTRAEIPM-LGEGETPFIRENFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAPLTTLGPV 187 L IP+ L EG TP R +AFTAVSMGNPHAVIFVDDVE + +G Sbjct: 118 ILEPGRIPVALAEGGTPSGRVEAA--GREWAFTAVSMGNPHAVIFVDDVEGTDVRGVGSE 175 Query: 188 LETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAVVASILNGKMERGK 247 +ET+ +FP RVNVEF+E L+ E+ RVWERG G T ACGTGACAAVVA L G+ G+ Sbjct: 176 VETNRLFPNRVNVEFVETLDPGEIRVRVWERGCGETLACGTGACAAVVAGALEGR--SGR 233 Query: 248 EITVHLAGGDLMIAWTEEGNVLMKGPAEVICRG 280 ++ VHL GG L I W E+G V M GPA + RG Sbjct: 234 KVRVHLPGGTLKIEWAEDGRVYMTGPAVEVFRG 266 Lambda K H 0.318 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 272 Length adjustment: 26 Effective length of query: 262 Effective length of database: 246 Effective search space: 64452 Effective search space used: 64452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_123809407.1 BTUS_RS07045 (diaminopimelate epimerase)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00652.hmm # target sequence database: /tmp/gapView.16250.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00652 [M=270] Accession: TIGR00652 Description: DapF: diaminopimelate epimerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-95 306.2 0.0 1.1e-95 306.0 0.0 1.0 1 lcl|NCBI__GCF_000092905.1:WP_123809407.1 BTUS_RS07045 diaminopimelate epi Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000092905.1:WP_123809407.1 BTUS_RS07045 diaminopimelate epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 306.0 0.0 1.1e-95 1.1e-95 6 268 .. 1 268 [. 1 270 [. 0.93 Alignments for each domain: == domain 1 score: 306.0 bits; conditional E-value: 1.1e-95 TIGR00652 6 mhGlgNdFvlvdevdeelvkeeaelvrkvcdrhtgvgaDgvllvepsseeadvklrifNsDGSeaemCG 74 mhGlgNdF++v+ l+ +l+r+ cdrh+g+gaDg+++v p s++adv++rifN+DGSeae+CG lcl|NCBI__GCF_000092905.1:WP_123809407.1 1 MHGLGNDFIVVEGHA--LPLDPGALARNWCDRHFGIGADGLVFVLP-SDRADVQMRIFNADGSEAEQCG 66 8***********998..5555579*********************8.********************** PP TIGR00652 75 NgiRcfakfvyekglkekkelsvetlaglikveveeen...kkvkvdmgepkfkkeeipltvekeeeke 140 N++Rc+ k++ e+gl+++++l+vetlag+ + + ++ ++v+vdmgep +++ ip+ ++ +++ lcl|NCBI__GCF_000092905.1:WP_123809407.1 67 NAVRCVGKYAFERGLVRRRDLVVETLAGVQRIVLGGNGsrvEEVTVDMGEPILEPGRIPVALAEGGTPS 135 ********************************99999998899******************65555544 PP TIGR00652 141 ellalev....l.vvdvGnPHlvvfvedvekldleelgklleaheefpegvNvefvevkkedeiklrvy 204 ++++ + +v++GnPH+v+fv+dve+ d+ +g+++e++ fp++vNvefve++++ ei++rv+ lcl|NCBI__GCF_000092905.1:WP_123809407.1 136 GRVEAAGrewaFtAVSMGNPHAVIFVDDVEGTDVRGVGSEVETNRLFPNRVNVEFVETLDPGEIRVRVW 204 3333333454427******************************************************** PP TIGR00652 205 ERGageTlaCGtGavAsavvalklgktkkkvtvhleggeLeievkedgkvyltGpavlvlegel 268 ERG geTlaCGtGa+A++v+++ g++ +kv+vhl+gg L+ie+ edg+vy+tGpav v++ge+ lcl|NCBI__GCF_000092905.1:WP_123809407.1 205 ERGCGETLACGTGACAAVVAGALEGRSGRKVRVHLPGGTLKIEWAEDGRVYMTGPAVEVFRGEI 268 **************************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (272 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.90 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory