Align 3-isopropylmalate/3-methylmalate dehydrogenase; 3-isopropylmalate dehydrogenase; 3-IPM-DH; IMDH; IPMDH; Beta-IPM dehydrogenase; D-malate dehydrogenase [decarboxylating]; EC 1.1.1.85; EC 1.1.1.n5; EC 1.1.1.83 (characterized)
to candidate WP_139796557.1 B9A12_RS08395 isocitrate/isopropylmalate family dehydrogenase
Query= SwissProt::Q58130 (333 letters) >NCBI__GCF_900176285.1:WP_139796557.1 Length = 171 Score = 150 bits (380), Expect = 2e-41 Identities = 79/169 (46%), Positives = 108/169 (63%), Gaps = 3/169 (1%) Query: 165 VTCAHKANVLKLTDGLFKKIFYKVAEEYDDIKAEDYYIDAMNMYIITKPQVFDVVVTSNL 224 +T A K+N + T + + F +AE+Y D++A+ Y+ID + + + P FDVVV SNL Sbjct: 1 MTSATKSNGIVHTMPFWDERFKAMAEQYPDVRADQYHIDILTAHFVLHPDWFDVVVGSNL 60 Query: 225 FGDILSDGAAGTVGGLGLAPSANIGDEH---GLFEPVHGSAPDIAGKKIANPTATILSAV 281 GDIL D GG+G+APSAN+ E +FEPVHGSAPDIAGK IANP AT+ Sbjct: 61 LGDILFDLGPAVAGGIGIAPSANLNPERRFPSMFEPVHGSAPDIAGKGIANPIATLWCVQ 120 Query: 282 LMLRYLGEYEAADKVEKALEEVLALGLTTPDLGGNLNTFEMAEEVAKRV 330 +ML +LGE +AA+ + +A+E V A G+ TPDLGG T E + V R+ Sbjct: 121 MMLDFLGETKAAEALMQAIETVTADGILTPDLGGTAKTVEFTDRVIARI 169 Lambda K H 0.318 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 171 Length adjustment: 23 Effective length of query: 310 Effective length of database: 148 Effective search space: 45880 Effective search space used: 45880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory