Align N-(5'-phosphoribosyl)anthranilate isomerase; PRAI; EC 5.3.1.24 (uncharacterized)
to candidate WP_177193591.1 BM091_RS08350 phosphoribosylanthranilate isomerase
Query= curated2:B8FA39 (218 letters) >NCBI__GCF_900114975.1:WP_177193591.1 Length = 225 Score = 154 bits (389), Expect = 1e-42 Identities = 88/216 (40%), Positives = 120/216 (55%), Gaps = 8/216 (3%) Query: 5 IKICGLTDPDRAAECFELGADAVGLVFYPPSPRFVIDDLALEICQALPKSAPKVGVFVND 64 IKICG+T A C + G DA+G VFYPPSPR V + I + GVFV + Sbjct: 9 IKICGITSVKDARVCVDAGVDALGFVFYPPSPRAVTAETVRSIISDVGNDVVFFGVFVKE 68 Query: 65 TYEFIMNKAERCGITMAQLHGHESQELADRLEKAGIGVIKAFFANRSPDFKAMTEYSAQA 124 + E I+ + GI +AQLHG ES+E+ L + G+ V KA FA R P F + Y A Sbjct: 69 SPEEILRIRDITGIEVAQLHGDESREVVTALRREGLKVCKALFAKRKPFFSDVNLYFCDA 128 Query: 125 CLVECAGEKLPGGNAKAWAWRTARGISERMPLA-----LAGGLDPENVSQAILDAMPDAL 179 L+E AG GG + W WR AR +E++ A +AGG++PENV + MP + Sbjct: 129 FLLE-AGRSGLGGTGEEWEWREARETTEKIISAGGFALIAGGINPENVGHVVRGVMPSGI 187 Query: 180 DVSSGVEASPGVKDMDKVKRFIQNATQTGIDYQPRK 215 DVSSGVE PGVKD KV+ ++ G+ ++ R+ Sbjct: 188 DVSSGVELRPGVKDERKVRTLVEKV--KGVFHETRQ 221 Lambda K H 0.319 0.135 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 218 Length of database: 225 Length adjustment: 22 Effective length of query: 196 Effective length of database: 203 Effective search space: 39788 Effective search space used: 39788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory