Align 3-isopropylmalate dehydratase small subunit; EC 4.2.1.33; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase (uncharacterized)
to candidate WP_232311000.1 AKL27_RS28455 aconitase family protein
Query= curated2:A1K4A2 (212 letters) >NCBI__GCF_001189915.1:WP_232311000.1 Length = 156 Score = 85.1 bits (209), Expect = 6e-22 Identities = 43/91 (47%), Positives = 56/91 (61%) Query: 119 NSFKNGLLPIKLDAAELDVLFQQCEATEGYRLKVDLAAQTITRPDGKAIAFDVDPFRKEC 178 N + GLLP+ L A + LF++ E GY L VDL QTI+ DG F + F K C Sbjct: 59 NDDRYGLLPVALGDAAIGYLFRKAEQVPGYCLHVDLQQQTISDDDGWRQEFAISAFTKTC 118 Query: 179 LLNGWDDIGLTLRHADKIRDFEAKRRAEHPY 209 LL GWDDIGLTL H+ +I+ FE +R A+ P+ Sbjct: 119 LLEGWDDIGLTLAHSVEIKAFEQRRFAQRPW 149 Lambda K H 0.323 0.141 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 85 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 156 Length adjustment: 19 Effective length of query: 193 Effective length of database: 137 Effective search space: 26441 Effective search space used: 26441 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory