Align Putative branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42; Transaminase B (uncharacterized)
to candidate WP_245619866.1 Q366_RS03525 aminotransferase class IV
Query= curated2:O29329 (290 letters) >NCBI__GCF_000745975.1:WP_245619866.1 Length = 278 Score = 152 bits (383), Expect = 1e-41 Identities = 98/272 (36%), Positives = 148/272 (54%), Gaps = 10/272 (3%) Query: 4 VYMDGEFVPENEAKVSIFDHGFLYGDGVFEGIRAYNGRVFRLKEHIDRLYDSAKAIDLEI 63 VY+DG+F+P ++A + + D L G V + IR + GR + L EH++RL S I L Sbjct: 7 VYVDGKFLPWDKAVIPVDDLAVLRGYAVCDIIRTFGGRPYCLDEHVNRLLSSVTTIGLTP 66 Query: 64 PITKEEFMEIILETLRKN-NLRDAYIRPIVTRGIGDLGLDPRKCQNPSIIVITKPWGKLY 122 TKEE I+ L KN ++ +A IR +VT G P +P +IV+ L Sbjct: 67 AWTKEEIKTIVFNVLEKNAHMDEANIRILVTGGSSPDFFSP--ADHPRLIVLVTDIPALP 124 Query: 123 GDLYEKGLTAITVAVRRNSFDALPPNIKSLNYLNNILAKIEANAKGGDEAIFLDRNGYVS 182 Y KG+ IT +R+ P+ K+ NY+ +LA +A A+G EA+++ R+ V Sbjct: 125 AHWYTKGVKVITFVQQRSL-----PDAKATNYIPAVLALKKAKAQGAAEALYMTRDKMVL 179 Query: 183 EGSGDNIFVVKNGAITTPPTINNLRGITREAVIEIINRLGIPFKETNIGLYDLYTADEVF 242 EG+ N+F + +G + TP L+GITR+ V+ + +L P E +I L L +A E+F Sbjct: 180 EGTTSNLFALVDGTLVTPEK-GVLKGITRKTVLALGKKL-FPVSEQDIALDTLLSASELF 237 Query: 243 VTGTAAEIAPIVVIDGRKIGDGKPGEITRKLM 274 +TGT I P++ +D IG G PG TR LM Sbjct: 238 ITGTNKGIVPVIQVDDHVIGTGMPGPGTRALM 269 Lambda K H 0.319 0.142 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 278 Length adjustment: 26 Effective length of query: 264 Effective length of database: 252 Effective search space: 66528 Effective search space used: 66528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory