Align 2-isopropylmalate synthase 2; EC 2.3.3.13; Alpha-IPM synthase 2; Alpha-isopropylmalate synthase 2 (uncharacterized)
to candidate WP_245619902.1 Q366_RS07565 hypothetical protein
Query= curated2:Q8RCF9 (384 letters) >NCBI__GCF_000745975.1:WP_245619902.1 Length = 407 Score = 287 bits (734), Expect = 4e-82 Identities = 162/377 (42%), Positives = 226/377 (59%), Gaps = 4/377 (1%) Query: 6 DKPVYIVDTTLRDGEQTAGVVFANNEKIRIAQMLDEIGIDQLEVGIPTMGGDEKETVAKI 65 D V++VDTTLRDGEQ GV F EK+ IA+ L E G+D++EVGIP MG + I Sbjct: 5 DLRVWMVDTTLRDGEQAPGVFFRPLEKLTIARQLAECGVDEIEVGIPAMGEFACREIQAI 64 Query: 66 AKLGLKASIMAWNRAVVKDVQESLECGVDAVAISISTSDIHIEHKLKKTRQWVLDSMTEA 125 A+L L + + W RAV KD++ ++ C V IS TS I ++ +K WVL+++ E Sbjct: 65 AQLNLPSMLTCWCRAVKKDIELAIGCNTPGVHISFPTSSILLK-TFEKNEAWVLEALDET 123 Query: 126 VRFAKKEGVYVSVNAEDASRTDMNFLIEFARCAKQAGADRLRFCDTVGFLDPFKTYEMVK 185 VRF+++ VSV A+DA+RTDMNFL+ F R A + G R+R DTVG + P +M++ Sbjct: 124 VRFSRQYFDQVSVGAQDATRTDMNFLLRFCREAIELGVHRVRLADTVGMITPSALMDMIE 183 Query: 186 AIKDAVD-IEIEMHTHNDFGMATANALAGVKAGAKFVGVTVNGLGERAGNAALEEVVMAL 244 + + + +E H HND GMATANA++ V AGAK + VTVNGLGERAGNA LEE MAL Sbjct: 184 TLLIRLPGLALEFHGHNDLGMATANAVSAVDAGAKAISVTVNGLGERAGNARLEETAMAL 243 Query: 245 KYVYKMDLGIDTSRFREISEYVALASGRPLPPSKAIVGKNVFAHESGIHVDGALKNPYTY 304 + + S + VA SG+ + +K IVG +F+HESGIH G LKN +Y Sbjct: 244 FGIGAKKSNMRLSGLARLCNTVARFSGQQIHAAKPIVGSRIFSHESGIHCAGLLKNTQSY 303 Query: 305 EVFDPQEVGLE--RQIVIGKHSGTAALINKFKEYGRVLTEEEANLLLPHVRKMAIQLKRP 362 E++DP +VG RQ+V+G HSG+AA+ + + + A LLP VR A +P Sbjct: 304 ELYDPGQVGRRNPRQMVLGVHSGSAAIKHALAHRNINIDADAAQRLLPRVRAAAAAANKP 363 Query: 363 LFDKELMYLYEDVIVKG 379 + + L +Y + G Sbjct: 364 ISPELLESIYRRTLCAG 380 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 407 Length adjustment: 31 Effective length of query: 353 Effective length of database: 376 Effective search space: 132728 Effective search space used: 132728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory