Align 2-isopropylmalate synthase 2; EC 2.3.3.13; Alpha-IPM synthase 2; Alpha-isopropylmalate synthase 2 (uncharacterized)
to candidate WP_245779605.1 BM299_RS02215 homocitrate synthase
Query= curated2:Q8RCF9 (384 letters) >NCBI__GCF_900115975.1:WP_245779605.1 Length = 392 Score = 539 bits (1389), Expect = e-158 Identities = 261/366 (71%), Positives = 313/366 (85%) Query: 9 VYIVDTTLRDGEQTAGVVFANNEKIRIAQMLDEIGIDQLEVGIPTMGGDEKETVAKIAKL 68 +YI+DTTLRDGEQTAGVVFAN EK+RIA+ LDE+G+ Q+E GIP MGGDEK+ + KI + Sbjct: 14 IYIIDTTLRDGEQTAGVVFANREKVRIAKFLDEMGVHQIEAGIPVMGGDEKDAIKKICQS 73 Query: 69 GLKASIMAWNRAVVKDVQESLECGVDAVAISISTSDIHIEHKLKKTRQWVLDSMTEAVRF 128 GLKASIM WNR V+KD++ SLECGVDAVAISISTSDIHI+HKL+ +R+WVLD + +AV F Sbjct: 74 GLKASIMGWNRPVIKDIEASLECGVDAVAISISTSDIHIKHKLRTSREWVLDHVVKAVEF 133 Query: 129 AKKEGVYVSVNAEDASRTDMNFLIEFARCAKQAGADRLRFCDTVGFLDPFKTYEMVKAIK 188 AKKEG+Y+SVNAEDASR+D++FLI+FA+ AK+AGADRLR+CDTVG L+PF TY+ ++ I Sbjct: 134 AKKEGMYISVNAEDASRSDLDFLIKFAKAAKEAGADRLRYCDTVGILEPFTTYKNIRHIL 193 Query: 189 DAVDIEIEMHTHNDFGMATANALAGVKAGAKFVGVTVNGLGERAGNAALEEVVMALKYVY 248 D VDI IEMHTHNDFGMATANALAG+ AGA +VGVTV GLGERAGN+ALEEVVMALK+++ Sbjct: 194 DNVDINIEMHTHNDFGMATANALAGLMAGANWVGVTVIGLGERAGNSALEEVVMALKHLF 253 Query: 249 KMDLGIDTSRFREISEYVALASGRPLPPSKAIVGKNVFAHESGIHVDGALKNPYTYEVFD 308 K+DLG T FRE++EYV+ ASGR LP KAIVG N+FAHESGIH DGALKNP TYE F Sbjct: 254 KIDLGFKTEMFREVAEYVSRASGRELPAWKAIVGSNMFAHESGIHADGALKNPKTYEAFL 313 Query: 309 PQEVGLERQIVIGKHSGTAALINKFKEYGRVLTEEEANLLLPHVRKMAIQLKRPLFDKEL 368 P+EVGL+RQIV+GKHSGTAAL K+ EYG LTE +A LLP +R + +KRPLFDKEL Sbjct: 314 PEEVGLQRQIVVGKHSGTAALKAKYAEYGIRLTEHQAEELLPKIRSYTVSMKRPLFDKEL 373 Query: 369 MYLYED 374 MY+YED Sbjct: 374 MYIYED 379 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 517 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 392 Length adjustment: 30 Effective length of query: 354 Effective length of database: 362 Effective search space: 128148 Effective search space used: 128148 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory