Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (uncharacterized)
to candidate WP_245795482.1 B1C78_RS16900 homoserine kinase
Query= curated2:Q9RAM6 (319 letters) >NCBI__GCF_002000365.1:WP_245795482.1 Length = 287 Score = 144 bits (362), Expect = 3e-39 Identities = 93/264 (35%), Positives = 131/264 (49%), Gaps = 9/264 (3%) Query: 15 WLKGYDLGELLDLQGIASGITNTNYFVTTDNGRYVLTLFEEHSAEELPNFLD-LMTHLAE 73 +L+ Y LGEL D Q G + TD GR+ L FL+ L+ HLA Sbjct: 3 FLRHYALGELRDFQ---PGRRGRRGRLITDAGRFWLV-----GPGMTDPFLEALLEHLAG 54 Query: 74 RGIPCPHPVKNNAGRALGELNGKPAALVSCLAGRSLDNPMPQHCAAIGEVLARMHIAGAS 133 G+P P V+ + GR + L P ALV G+ P CA +G++L R+H+AG Sbjct: 55 HGLPVPTVVRGHDGRWIRSLGEYPGALVRWPEGQHPQRLEPDACARVGDLLGRIHLAGLE 114 Query: 134 FKAGMSNLRGQEWRIATAAKVAPFLDEENHRMLDAQLEFERTFDTRRLPRGVIHADLFRD 193 F R WR + +AP L E +L ++ F+ + LP+G IH R Sbjct: 115 FTQSRPPHRDHRWRRQSTDALAPDLTPEARTLLHEEIRFQGLYRHTDLPQGTIHGAPNRR 174 Query: 194 NVLMDGDKVGGVIDFYYACHDALLYDIAIAVNDWCVNADCTLDAVRVRAFLDAYHAIRPL 253 +++D G+ F +A ALL D+A+AVND C+ +D LD A L+AYH +RPL Sbjct: 175 RLVIDETGRVGLTGFGHASRCALLVDVAVAVNDCCIGSDGRLDRTLSAALLNAYHRLRPL 234 Query: 254 TGEEHAAWPGMLRVAAMRFWLSRL 277 E AWP +LR+AA+ WL L Sbjct: 235 RPIERGAWPVLLRLAALDGWLETL 258 Lambda K H 0.324 0.137 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 287 Length adjustment: 27 Effective length of query: 292 Effective length of database: 260 Effective search space: 75920 Effective search space used: 75920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory