Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_321162852.1 H035_RS0104045 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_000421465.1:WP_321162852.1 Length = 430 Score = 230 bits (586), Expect = 1e-64 Identities = 150/431 (34%), Positives = 231/431 (53%), Gaps = 17/431 (3%) Query: 366 DKVGVQKALSRPIQKTSE----IMHLVNPIIENVRDKGNSALLEYTEKFDGV-KLSNPVL 420 D G + L++ + T++ + V I+ VR +G++A+L YT +FD + +LS L Sbjct: 7 DDPGFAEQLTQLVAWTADFDQNVHQTVLEILGRVRQEGDAAVLAYTRRFDRLDRLSVAEL 66 Query: 421 NAPFP--EEYFEGLTEEMKEALDLSIENVRKFHAAQLPTETLEVETQPGVLCSRFPRPIE 478 P EE L E ++AL+ + +R + A + + + G L + P++ Sbjct: 67 EFPRARLEEALTTLPTEQRQALENAAARIRAY-AERQKLASWHYRDELGNLLGQQITPLD 125 Query: 479 KVGLYIPGGTAILPSTALMLGVPAQVAQCKEIVFASPPRKSDGKVSPEVVYVAEKVGASK 538 +VGLY+PGG A PS+ LM VPA+VA E++ P G+ + V+ A G + Sbjct: 126 RVGLYVPGGKAAYPSSVLMNAVPAKVAGVTELIMVVPT--PGGEANRLVLAAAAVAGVDR 183 Query: 539 IVLAGGAQAVAAMAYGTETIPKVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEV 598 + GGAQAVAA+AYGTETIP+VDKI+GPGN +V AK V IDM AGPSE+ Sbjct: 184 VFRVGGAQAVAALAYGTETIPQVDKIVGPGNIYVATAKKLVFGQV----GIDMIAGPSEI 239 Query: 599 LVIADEDADVDFVASDLLSQAEHGIDSQVILVGVNLSEKKIQEIQDAVHNQALQLPRVDI 658 L+IAD D D++A DL SQAEH D+Q IL+ + E + + ++ Q + R + Sbjct: 240 LIIADGTTDPDWIAMDLFSQAEHDEDAQAILLCPD--EAYLDRVAASIAKQLPGMERRAV 297 Query: 659 VRKCIA-HSTIVLCDGYEEALEMSNQYAPEHLILQIANANDYVKLVDNAGSVFVGAYTPE 717 +R + ++ +A E++N+ APEHL + +A+ + + +AG++F+G +T E Sbjct: 298 IRTSLEKRGALIKVRDLNQACEIANRIAPEHLEVSVADPEALLPELRHAGAIFLGPHTAE 357 Query: 718 SCGDYSSGTNHTLPTYGYARQYSGANTATFQKFITAQNITPEGLENIGRAVMCVAKKEGL 777 + GDY +G NH LPT G AR S FQK + T G + +AK E L Sbjct: 358 ALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRTSLIGCTALGASPLAETARILAKGESL 417 Query: 778 DGHRNAVKIRM 788 H + + R+ Sbjct: 418 TAHARSAEYRI 428 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 693 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 430 Length adjustment: 37 Effective length of query: 762 Effective length of database: 393 Effective search space: 299466 Effective search space used: 299466 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory