Align alanine racemase (EC 5.1.1.1) (characterized)
to candidate YP_001326795.1 Smed_1109 cystathionine beta-lyase
Query= BRENDA::P06721 (395 letters) >NCBI__GCF_000017145.1:YP_001326795.1 Length = 469 Score = 326 bits (835), Expect = 1e-93 Identities = 180/394 (45%), Positives = 246/394 (62%), Gaps = 15/394 (3%) Query: 2 ADKKLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEAKKHATRNRANGELFYGRRGT 61 A++ ++T+L + G + G VN + AS+++F + A+ TR++ + YG RGT Sbjct: 83 AEQGINTRLAHTGNNPSDYHGFVNPPVVHASTVLFPN--ARTMETRSQ---KYTYGTRGT 137 Query: 62 LTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKI 121 T +L +A+ ELEG AG +L P G AAV LA++ GDHVL+ ++ Y P++ FC + Sbjct: 138 PTTDALCEAINELEGAAGTILVPSGLAAVTVPFLAYLSSGDHVLIVDSVYFPTRHFCDTM 197 Query: 122 LSKLGVTTSWFDPLIGADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRSVVPDAI 181 L++LGVT ++DP IGA I ++PNT++V E+PGS T E+ D+PAI AA I Sbjct: 198 LTRLGVTVEYYDPSIGAGIENLIRPNTRLVHTEAPGSNTFEMQDIPAIAAAAHR--HGCI 255 Query: 182 IMIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTAVCNARCWEQLRENAYLMG 241 + +DNTWA V F+ LD+G+DVSI AATKY GHSD ++GT NA W L E +G Sbjct: 256 VTMDNTWATPVYFRPLDYGVDVSIHAATKYPSGHSDVLLGTVSANAAHWPALSEAMVTLG 315 Query: 242 QMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFWK 301 V D +Y RGLRT+GVRL +H S+L +AEWL +VARV HPALP GHE WK Sbjct: 316 VCVSPDDSYQILRGLRTMGVRLERHQASALAIAEWLEGREEVARVLHPALPSFPGHELWK 375 Query: 302 RDFTGSSGLFSFVLKKKLNN--EELANYLDNFSLFSMAYSWGGYESL-ILANQPEHIAAI 358 RDF G+SG+FSFVLK N + +LD S+F + YSWGG+ESL + N + A Sbjct: 376 RDFGGASGIFSFVLKADPENGKAKAHAFLDALSIFGLGYSWGGFESLAVHVNLSDRKVAK 435 Query: 359 RPQGEIDFSGTLIRLHIGLEDVDDLIADLDAGFA 392 PQ G +IRL IGLEDV D+ D++AG A Sbjct: 436 APQ-----EGPVIRLQIGLEDVPDIRRDVEAGLA 464 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 469 Length adjustment: 32 Effective length of query: 363 Effective length of database: 437 Effective search space: 158631 Effective search space used: 158631 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory