Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate YP_001327089.1 Smed_1408 anthranilate phosphoribosyltransferase
Query= SwissProt::P83827 (329 letters) >NCBI__GCF_000017145.1:YP_001327089.1 Length = 337 Score = 263 bits (672), Expect = 5e-75 Identities = 153/332 (46%), Positives = 197/332 (59%), Gaps = 9/332 (2%) Query: 4 VKKAILGEVLEEEEAYEVMRALMAGEVSPVRAAGLLVALSLRGERPHEIAAMARAMREAA 63 V K E L ++A +M+G +P + G L+AL +RGE EI AMR A Sbjct: 8 VAKVAAREALSRDDARAAFEIIMSGAATPSQIGGFLMALRVRGETVDEIVGAVGAMR--A 65 Query: 64 RPLRVHRRP-LLDIVGTGGDGKGLMNLSTLAALVAAAGGVAVAKHGNRAASSRAGSADLL 122 R L V +DIVGTGGDG G N+STLAAL+ A GV VAKHGNRA SS++G+AD L Sbjct: 66 RMLHVKAPDGSIDIVGTGGDGAGTYNISTLAALIVAGAGVPVAKHGNRALSSKSGTADAL 125 Query: 123 EALGVDLEAPPERVGEAIEELGFGFLFARVFHPAMRHVAPVRAELGVRTVFNLLGPLTNP 182 LGV+LE PE + I E G GF+FA+ H AMRHV P R ELG RT+FNLLGPL NP Sbjct: 126 SCLGVNLEIGPEAISRCIGEAGLGFMFAQQHHSAMRHVGPTRVELGTRTIFNLLGPLANP 185 Query: 183 AGADAYVLGVFSPEWLAPMAEALERLGARGL-VVHGEGADEL-VLGENRVVEVGKGA--- 237 AG ++GV++P+W+ P+AE L LG+ + VVHGEG DE+ G +V + G Sbjct: 186 AGVRQQLVGVYAPQWVDPLAEVLRDLGSESVWVVHGEGLDEITTTGVTKVAALKDGTITN 245 Query: 238 YALTPEEVGLKRAPLEALKGGGPEENAALARRLLKGEEKGPLADAVALAAGAGFYAAGKT 297 + LTP + GL+R L+ALKGG NAA + +L G E D A A AG+ Sbjct: 246 FELTPADFGLERVTLDALKGGDGAHNAAALQAVLDGAENA-YRDISLANAAASLMIAGRA 304 Query: 298 PSLKEGVALAREVLASGEAYLLLERYVAFLRA 329 L EG+ LAR+ L+SG A + L+R + A Sbjct: 305 KDLMEGMDLARKSLSSGAAKVALQRLITVSNA 336 Lambda K H 0.317 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 337 Length adjustment: 28 Effective length of query: 301 Effective length of database: 309 Effective search space: 93009 Effective search space used: 93009 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate YP_001327089.1 Smed_1408 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.24583.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-121 389.5 1.3 7.8e-121 389.3 1.3 1.0 1 lcl|NCBI__GCF_000017145.1:YP_001327089.1 Smed_1408 anthranilate phosphori Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000017145.1:YP_001327089.1 Smed_1408 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 389.3 1.3 7.8e-121 7.8e-121 2 328 .. 9 331 .. 8 333 .. 0.98 Alignments for each domain: == domain 1 score: 389.3 bits; conditional E-value: 7.8e-121 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeesee 70 k++ ++ Ls+++a+++++ imsg a+++qi+ +l+alrv+get++ei+g++ a+r+++ +v++ + lcl|NCBI__GCF_000017145.1:YP_001327089.1 9 AKVAAREALSRDDARAAFEIIMSGAATPSQIGGFLMALRVRGETVDEIVGAVGAMRARMLHVKA--PDG 75 588999********************************************************88..699 PP TIGR01245 71 lvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsle 139 +DivGTGGDg+ t+NiST +al++a+aGv+vaKhGnr+ ssksG aD L+ lgvnle+ pe++ r++ lcl|NCBI__GCF_000017145.1:YP_001327089.1 76 SIDIVGTGGDGAGTYNISTLAALIVAGAGVPVAKHGNRALSSKSGTADALSCLGVNLEIGPEAISRCIG 144 ********************************************************************* PP TIGR01245 140 evgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgv 208 e g+gF+fA ++h+a+++v p+R eLg+rt+fNlLGPL+nPa ++ q++Gvy ++ v+ laevl+ lg+ lcl|NCBI__GCF_000017145.1:YP_001327089.1 145 EAGLGFMFAQQHHSAMRHVGPTRVELGTRTIFNLLGPLANPAGVRQQLVGVYAPQWVDPLAEVLRDLGS 213 ********************************************************************* PP TIGR01245 209 kralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevleg 277 + + vvhg +glDEi++tg tkva lkdg+i++++l+p+dfgl+r +l++lkgg+ ++na++l++vl g lcl|NCBI__GCF_000017145.1:YP_001327089.1 214 ESVWVVHG-EGLDEITTTGVTKVAALKDGTITNFELTPADFGLERVTLDALKGGDGAHNAAALQAVLDG 281 ********.************************************************************ PP TIGR01245 278 kekkakrdivvlNaaaalyvagkakdlkegvelakeaiksgkalekleelv 328 e +a rdi ++Naaa l++ag+akdl eg++la+++++sg+a l++l+ lcl|NCBI__GCF_000017145.1:YP_001327089.1 282 AE-NAYRDISLANAAASLMIAGRAKDLMEGMDLARKSLSSGAAKVALQRLI 331 99.899**************************************9999987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (337 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.30 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory