Align Cystathionine beta-lyase; CBL; Beta-cystathionase; Cysteine lyase; Cysteine-S-conjugate beta-lyase; EC 4.4.1.13 (characterized)
to candidate YP_001327869.1 Smed_2201 methionine gamma-lyase
Query= SwissProt::Q83A83 (387 letters) >NCBI__GCF_000017145.1:YP_001327869.1 Length = 427 Score = 215 bits (548), Expect = 2e-60 Identities = 146/416 (35%), Positives = 210/416 (50%), Gaps = 38/416 (9%) Query: 6 NKKSHIDTRVIHAGQKPDPLTGAVMTPIYTASTYAQKSP------------------GVH 47 N K H +T +++ G P+ GAV PI+ ST+ S GV Sbjct: 13 NHKLHPETLMLNYGYDPELSEGAVKPPIFLTSTFVFHSAEEGRDFFDFVSGRREPPEGVG 72 Query: 48 QGYEYSRSQNPTRFAYERCVADLESGQHGFAFASGMAATAT-ILELLQPGDHVVVMDDVY 106 G YSR +P E +A E + G F+SGM+A AT +L ++PGD ++ +Y Sbjct: 73 AGLVYSRFNHPNSEIVEDRLAIYERAEAGALFSSGMSAIATTLLAFVRPGDSILHSQPLY 132 Query: 107 GGSYRLFENVRKRSAGLSFSFVDFTDENKVREAVT-----AKTKMLWVESPSNPRLKIVD 161 GG+ L + F D DE V A + M+ +E+P+NP +VD Sbjct: 133 GGTETLLAKTFLNLGISATGFADGVDEAAVSAAAEEAMSKGRVSMILIETPANPTNSLVD 192 Query: 162 LAKIAEIAKE------KNIIAVADNTFATPIIQRPLELGFDIVTHSATKYLNGHSDIIGG 215 +A I IA+ I DNT P+ Q P+E G D+ +S TKY+ GHSD+I G Sbjct: 193 VAMIRRIAERIEERQAHRPIVACDNTLLGPVFQHPIEHGADLSLYSLTKYVGGHSDLIAG 252 Query: 216 VAVVGDNKTLAEQLKYLQNAIGAIAAPFDSFMVLRGLKTLAIRMERHCENAMQLAQWLEK 275 AV+G +K L Q+K L+ +IG P +M+ R L+TL++RME+ ENA +A++L Sbjct: 253 -AVLG-SKALIRQVKALRGSIGTQLDPHSCWMIGRSLETLSVRMEKANENARIVAEFLRD 310 Query: 276 HPKVKRVYYPGLPSH----PQHSIAKKQMRYFGGMISVELKCDLNETKKVLERCQLFTLA 331 HPKV+ ++Y LP H P + Q G S ++ + L Q+F LA Sbjct: 311 HPKVEHIHY--LPFHDPEAPVGRVFAAQCTGAGSTFSFDIAGGQEAAFRFLNALQIFKLA 368 Query: 332 ESLGGVESLIEHPAIMTHASIPQAERQKLGITDGFIRLSVGIEAITDLRHDLEAAL 387 SLGG ESL HPA MTH+ +P R ++G+ + IRLS+GIE DL D+ AL Sbjct: 369 VSLGGTESLASHPAAMTHSGVPIEVRARIGVLESTIRLSIGIEHPDDLVADVANAL 424 Lambda K H 0.319 0.134 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 16 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 427 Length adjustment: 31 Effective length of query: 356 Effective length of database: 396 Effective search space: 140976 Effective search space used: 140976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory