Align candidate YP_001327962.1 Smed_2295 (anthranilate synthase)
to HMM TIGR01815 (anthranilate synthase (EC 4.1.3.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01815.hmm # target sequence database: /tmp/gapView.20123.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01815 [M=717] Accession: TIGR01815 Description: TrpE-clade3: anthranilate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 0 1383.4 0.0 0 1383.2 0.0 1.0 1 lcl|NCBI__GCF_000017145.1:YP_001327962.1 Smed_2295 anthranilate synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000017145.1:YP_001327962.1 Smed_2295 anthranilate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 1383.2 0.0 0 0 1 717 [] 13 729 .] 13 729 .] 1.00 Alignments for each domain: == domain 1 score: 1383.2 bits; conditional E-value: 0 TIGR01815 1 yrtkGgvvvtrratevkletaleevvdalderrGallsssyeypGrykrwalgfvdppvalsasGrtlr 69 y+tkGg+vv rr++e+++ +a++++vd+lderrGa++ss+yeypGry+rw++++vdpp+a+s++Gr+l+ lcl|NCBI__GCF_000017145.1:YP_001327962.1 13 YTTKGGIVVNRRRREASYTEAIAGYVDRLDERRGAVFSSNYEYPGRYTRWDTAVVDPPLAISSFGRSLW 81 89******************************************************************* PP TIGR01815 70 iealnerGevllpviaealkkvedlakleeaarrvtasvkspdevlaeeerskqpsvftvlravldlfa 138 iea+nerGevll++iae+lk+v d++ ++++ rr+++++++pd+v++eeersk+p+vftvlrav+dlf+ lcl|NCBI__GCF_000017145.1:YP_001327962.1 82 IEAYNERGEVLLALIAEDLKSVSDITLGTLTDRRLDLTINEPDRVFTEEERSKMPTVFTVLRAVTDLFH 150 ********************************************************************* PP TIGR01815 139 seedellGlyGafgydlafqfeaieqklerpddqrdlvlylpdelvvvdyyaakaflveydfitaagst 207 seed++lGlyGafgydlafqf+aie+kl rp+dqrd+vl+lpde++vvd+yaaka++++ydf+++ +st lcl|NCBI__GCF_000017145.1:YP_001327962.1 151 SEEDSNLGLYGAFGYDLAFQFDAIELKLTRPEDQRDMVLFLPDEILVVDHYAAKAWIDRYDFAKEGLST 219 ********************************************************************* PP TIGR01815 208 egleadgedepyrsdtsiepqadhkpGeyaklvekakeafrrGdlfevvpgqkffeaceaapsevferl 276 e+++ad+++e +rs++si+p++dh+pGeya+lv+kake+frrGdlfevvpgqkf+e+c+++pse+++rl lcl|NCBI__GCF_000017145.1:YP_001327962.1 220 EDKAADIAPEAFRSVDSIPPHGDHRPGEYAELVVKAKESFRRGDLFEVVPGQKFYERCDSRPSEISNRL 288 ********************************************************************* PP TIGR01815 277 kainpspyeffvnlGrgeylvgaspemfvrveGrrvetcpisGtikrGddaiddaaqilkllnskkdea 345 kainpspy+ff+nlG++eylvgaspemfvrv+Grr+etcpisGtikrGdd+i+d++qilkllnskkde+ lcl|NCBI__GCF_000017145.1:YP_001327962.1 289 KAINPSPYSFFINLGNQEYLVGASPEMFVRVSGRRIETCPISGTIKRGDDPIADSEQILKLLNSKKDES 357 ********************************************************************* PP TIGR01815 346 eltmctdvdrndksrvcepGsvkviGrrqielysrlihtvdhveGrlrdeldaldaflshawavtvtGa 414 eltmc+dvdrndksrvc+pGsvkviGrrqie+ysrlihtvdh+eGrlrd++da+d+flshawavtvtGa lcl|NCBI__GCF_000017145.1:YP_001327962.1 358 ELTMCSDVDRNDKSRVCVPGSVKVIGRRQIEMYSRLIHTVDHIEGRLRDDMDAFDGFLSHAWAVTVTGA 426 ********************************************************************* PP TIGR01815 415 pkraalqfiekteksprrwyGGavGrlgfnGdlntGltlrtirlkdgiaevraGatllydsdpeaeeae 483 pk++a++fie++ekspr+wyGGa+G++gfnGd+ntGltlrtir+kdgiaevraGatllyds+pe+eeae lcl|NCBI__GCF_000017145.1:YP_001327962.1 427 PKLWAMRFIESHEKSPRAWYGGAIGMVGFNGDMNTGLTLRTIRIKDGIAEVRAGATLLYDSNPEEEEAE 495 ********************************************************************* PP TIGR01815 484 telkaaalieairdakaadaakeesavakvgeGkrillvdhedsfvhtlanylrqtGasvttlrhsvae 552 telka+a+i+airdak+a++a+ +++va+vg+G++illvdhedsfvhtlany+rqtGa+vtt+r++vae lcl|NCBI__GCF_000017145.1:YP_001327962.1 496 TELKASAMIAAIRDAKSANSANAARDVAAVGAGVSILLVDHEDSFVHTLANYFRQTGATVTTVRTPVAE 564 ********************************************************************* PP TIGR01815 553 elldeerpdlvvlspGpGrpkdfdvketikaalardlpvfGvclGlqglveafGGeldvlaepvhGkas 621 e++d+++pdlvvlspGpG+pkdfd+k+tik+a+ar+lp+fGvclGlq+l+ea+GG+l++la+p+hGk+s lcl|NCBI__GCF_000017145.1:YP_001327962.1 565 EIFDRVKPDLVVLSPGPGNPKDFDCKATIKKARARELPIFGVCLGLQALAEAYGGNLRQLAVPMHGKPS 633 ********************************************************************* PP TIGR01815 622 rirvlepdvlfaglpeeltvGryhslfarsdrlpkelkvtaesedgvimaiehrklpvaavqfhpesil 690 rirvlep+++f+gl++e+tvGryhs+fa+++ lp+e+++taesedg+im+ieh k+pvaavqfhpesi+ lcl|NCBI__GCF_000017145.1:YP_001327962.1 634 RIRVLEPGIVFSGLGKEVTVGRYHSIFADPSGLPREFMITAESEDGTIMGIEHTKEPVAAVQFHPESIM 702 ********************************************************************* PP TIGR01815 691 tlaGeaGlalienvvdklaksaktkaa 717 tl+G+aG+++ienvv++lak+ak kaa lcl|NCBI__GCF_000017145.1:YP_001327962.1 703 TLGGDAGMRMIENVVAHLAKRAKIKAA 729 **********************99886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (717 nodes) Target sequences: 1 (729 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.05u 0.02s 00:00:00.07 Elapsed: 00:00:00.05 # Mc/sec: 9.57 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory