Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate YP_001328819.1 Smed_3160 class I and II aminotransferase
Query= metacyc::MONOMER-21143 (387 letters) >NCBI__GCF_000017145.1:YP_001328819.1 Length = 410 Score = 230 bits (587), Expect = 5e-65 Identities = 128/390 (32%), Positives = 208/390 (53%), Gaps = 13/390 (3%) Query: 4 AKNLQRLGTESAFSVLAEAKKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGHHGY 63 A + +G + A A ++ +GKP+I LG G+PDF TP HV AA A+ G Y Sbjct: 15 ASRISSIGVSEILKIGARAAAMKREGKPVIILGAGEPDFDTPDHVKQAASDAIHRGETKY 74 Query: 64 VLSNGILECRQAVTRKIKKLYNKDIDPERVLIMPGGKPTMYYAIQCFGEPGAEIIHPTPA 123 +G E ++A+ K ++ + + + + G K ++ A+ +PG E++ PTP Sbjct: 75 TALDGTPELKKAIREKFQRENGLAYELDEITVATGAKQILFNAMMASLDPGDEVVIPTPY 134 Query: 124 FPIYESMINYTGSTPVPYDLTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFVEKS 183 + Y ++ P+ + +K+ + IT +TR ++L +P+NP+G+ + Sbjct: 135 WTSYSDIVQICEGKPILIACDASSGFRLTAQKLEAAITPRTRWVLLNSPSNPSGAAYSAA 194 Query: 184 AIDVLAEGLKKHPHVAILSDEIYSRQIYDGKEMPTFFNY-PDLQDRLIVLDGWSKAYAMT 242 L + L KHPHV +L D++Y +YD T P L+DR + ++G SKAYAMT Sbjct: 195 DYRPLLDVLLKHPHVWLLVDDMYEHIVYDAFRFVTPARLEPGLKDRTLTVNGVSKAYAMT 254 Query: 243 GWRMGWSVWPEELIPHVNKLIINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQRRKL 302 GWR+G++ P LI + + + SC ++ SQ A +AAL+GP D + E F +RR L Sbjct: 255 GWRIGYAGGPRALIKAMAVVQSQATSCPSSVSQAASVAALNGPQDFLKERTESFQRRRNL 314 Query: 303 IHEGLNSLPGVECSLPGGAFYAFP-------KVIGTGM---NGSEFAKKCMHEAGVAIVP 352 + GLN++ G++C +P GAFY F +V +G + ++F + ++ VA+VP Sbjct: 315 VVNGLNAIEGLDCRVPEGAFYTFSGCAGVLGRVTPSGKRIESDTDFCAYLLEDSHVAVVP 374 Query: 353 GTAFGKTCQDYVRFSYAASQDNISNALENI 382 G+AFG Y R SYA S+ + ALE I Sbjct: 375 GSAFG--LSPYFRISYATSEAELKEALERI 402 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 410 Length adjustment: 31 Effective length of query: 356 Effective length of database: 379 Effective search space: 134924 Effective search space used: 134924 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory