Align 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 (characterized)
to candidate YP_002822243.1 NGR_b00160 dihydrodipicolinate synthetase
Query= SwissProt::Q9JZR4 (291 letters) >NCBI__GCF_000018545.1:YP_002822243.1 Length = 297 Score = 119 bits (297), Expect = 1e-31 Identities = 88/280 (31%), Positives = 126/280 (45%), Gaps = 4/280 (1%) Query: 10 ITPMNQDGSIHYEQLRDLIDWHIENGTDGIVAVGTTGESATLSVEEHTAVIEAVVKHVAK 69 ITP + G + L L++ G D I +G+TG A LS +E +EA + V Sbjct: 12 ITPTDASGHVDTAALARLLERIRLAGADSIGLLGSTGGYAFLSRDERRCAVEAAMACVGG 71 Query: 70 RVPVIAGTGANNTVEAIALSQAAEKAGADYTLSVVPYYNKPSQEGIYQHFKTIAEATSIP 129 R+PVI G GA T +A AL++ A AGAD L Y E +YQHF +A+A +P Sbjct: 72 RIPVIVGVGALRTDDAQALARDARAAGADGLLLAPMSYTPLLDEEVYQHFAAVADAGDLP 131 Query: 130 MIIYNVPGRTVVSMTNDTILRLAEIPNIVGVK---EASGNI-GSNIELINRAPEGFVVLS 185 + IYN PG T + +N I RL+++ + VK G+ G L GF + Sbjct: 132 LSIYNNPGTTRFTFSNALIGRLSKVAKVAAVKMPLPPDGDFKGEMARLRTETAPGFSIGY 191 Query: 186 GDDHTALPFMLCGGHGVITVAANAAPKLFADMCRAALQGDIALARELNDRLIPIYDTMFC 245 D A +L G +V A P + RAA GD++ L+ P++ Sbjct: 192 SGDWGAAAALLSGCDAWYSVVAGLLPAEAMALTRAARAGDLSEVERLDRAFQPLWSLFKA 251 Query: 246 EPSPAAPKWAVSALGRCEPHVRLPLVPLTENGQAKVRAAL 285 S ALG C P++PL +VR+AL Sbjct: 252 FGSFRVMYAIAEALGLCRAEPPRPILPLPSTEIPRVRSAL 291 Lambda K H 0.317 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 297 Length adjustment: 26 Effective length of query: 265 Effective length of database: 271 Effective search space: 71815 Effective search space used: 71815 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory