Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (characterized)
to candidate YP_002824625.1 NGR_c00680 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
Query= CharProtDB::CH_024869 (274 letters) >NCBI__GCF_000018545.1:YP_002824625.1 Length = 285 Score = 331 bits (849), Expect = 9e-96 Identities = 175/280 (62%), Positives = 212/280 (75%), Gaps = 10/280 (3%) Query: 1 MQQLQNIIETAFERRAEITPANADTVTREAVNQVIALLDSGALRVAEK-IDGQWVTHQWL 59 + L IETAFE R ++ + + R+AV + LLDSG +RVAE+ DG W +QWL Sbjct: 6 LASLSQTIETAFEDREAVSTSTRGAI-RDAVEAALNLLDSGKVRVAERGADGTWTVNQWL 64 Query: 60 KKAVLLSFRINDNQVIEGA--ESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQGAFI 117 KKAVLLSFR+N ++++G ES ++DKV KF + F+K GFR VP VR+ A+I Sbjct: 65 KKAVLLSFRLNPMELVKGGPGESVWWDKVASKFDGWSVNEFEKAGFRAVPNCVVRRSAYI 124 Query: 118 ARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177 A N +LMPS+VN+GAYV EGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEP+QA PTI Sbjct: 125 APNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTI 184 Query: 178 IEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVSGN 237 IEDNCFIGARSEVVEG IV EGSV+ MGV+IG+ST+I DR TGE+ YG VP SVVV+G+ Sbjct: 185 IEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVTYGEVPPYSVVVAGS 244 Query: 238 LPS----KDGK--YSLYCAVIVKKVDAKTRGKVGINELLR 271 +PS +G+ +LYCAVIVK+VD KTR K GINELLR Sbjct: 245 MPSGSTMANGQPAPNLYCAVIVKRVDEKTRSKTGINELLR 284 Lambda K H 0.318 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 285 Length adjustment: 26 Effective length of query: 248 Effective length of database: 259 Effective search space: 64232 Effective search space used: 64232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate YP_002824625.1 NGR_c00680 (2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase)
to HMM TIGR00965 (dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00965.hmm # target sequence database: /tmp/gapView.10781.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00965 [M=271] Accession: TIGR00965 Description: dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-128 412.1 0.4 6.3e-128 411.9 0.4 1.0 1 lcl|NCBI__GCF_000018545.1:YP_002824625.1 NGR_c00680 2,3,4,5-tetrahydropyr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000018545.1:YP_002824625.1 NGR_c00680 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransfera # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 411.9 0.4 6.3e-128 6.3e-128 2 269 .. 9 284 .. 8 285 .] 0.94 Alignments for each domain: == domain 1 score: 411.9 bits; conditional E-value: 6.3e-128 TIGR00965 2 lqkiietaferraeilpasklikvkeavnesiasldsgalrvaekl.dgqwkvnewvkkavllsfritd 69 l + ietafe r+ + + + +++av+ +++ ldsg++rvae+ dg w vn+w+kkavllsfr++ lcl|NCBI__GCF_000018545.1:YP_002824625.1 9 LSQTIETAFEDREAVSTS-TRGAIRDAVEAALNLLDSGKVRVAERGaDGTWTVNQWLKKAVLLSFRLNP 76 6789********988755.56789*********************879********************* PP TIGR00965 70 nqvlnd..avnkyfdkvatkfadydedefkeaglrkvpgavvrrgafiaknvvlmpsyvnigayvdegt 136 +++++ +++ ++dkva+kf ++ +ef++ag+r+vp+ vvrr a+ia n +lmps+vn+gayv egt lcl|NCBI__GCF_000018545.1:YP_002824625.1 77 MELVKGgpGESVWWDKVASKFDGWSVNEFEKAGFRAVPNCVVRRSAYIAPNAILMPSFVNLGAYVGEGT 145 ****98335899********************************************************* PP TIGR00965 137 mvdtwatvgscaqigknvhlsggvgiggvleplqakpviiedncfigarseivegviveegsvismgvf 205 mvdtwatvgscaqigknvhlsggvgiggvlep+qa p+iiedncfigarse+veg iv egsv+ mgvf lcl|NCBI__GCF_000018545.1:YP_002824625.1 146 MVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVF 214 ********************************************************************* PP TIGR00965 206 igqstkivdretgeiiygrvpagsvvvsgslps....kdgk..kslycavivkkvdaktrgkvsinell 268 ig+stkivdr tge+ yg vp +svvv+gs+ps +g+ ++lycavivk+vd+ktr+k++inell lcl|NCBI__GCF_000018545.1:YP_002824625.1 215 IGKSTKIVDRATGEVTYGEVPPYSVVVAGSMPSgstmANGQpaPNLYCAVIVKRVDEKTRSKTGINELL 283 ********************************9644335652257************************ PP TIGR00965 269 r 269 r lcl|NCBI__GCF_000018545.1:YP_002824625.1 284 R 284 9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (271 nodes) Target sequences: 1 (285 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.13 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory