GapMind for Amino acid biosynthesis

 

Alignments for a candidate for B12-reactivation-domain in Sinorhizobium fredii NGR234

Align candidate YP_002827542.1 NGR_c30540 (B12-dependent methionine synthase)
to HMM PF02965 (Met_synt_B12)

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/PF02965.21.hmm
# target sequence database:        /tmp/gapView.13638.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       Met_synt_B12  [M=273]
Accession:   PF02965.21
Description: Vitamin B12 dependent methionine synthase, activation domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
     8e-129  414.9   0.0   1.2e-128  414.3   0.0    1.3  1  lcl|NCBI__GCF_000018545.1:YP_002827542.1  NGR_c30540 B12-dependent methion


Domain annotation for each sequence (and alignments):
>> lcl|NCBI__GCF_000018545.1:YP_002827542.1  NGR_c30540 B12-dependent methionine synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  414.3   0.0  1.2e-128  1.2e-128       1     272 [.     958    1229 ..     958    1230 .. 0.99

  Alignments for each domain:
  == domain 1  score: 414.3 bits;  conditional E-value: 1.2e-128
                              Met_synt_B12    1 dleelveyidWtpffqaWelkgkypkiledekvgeeakklfkdAqamLkkiieekllkakavvglfp 67  
                                                dl+el++yidWtpffq+Welkg yp+il+de++g +a++lf+dAqamL+kii+ek++  kavvg++p
  lcl|NCBI__GCF_000018545.1:YP_002827542.1  958 DLAELARYIDWTPFFQTWELKGVYPRILDDEHQGPAARQLFADAQAMLEKIIAEKWFAPKAVVGFWP 1024
                                                699**************************************************************** PP

                              Met_synt_B12   68 AnsegddievyadesrseelatlhtLrqqaekeegkpnlclaDfvapkesgvkDyiGlFavtaglgi 134 
                                                A s gddi +++de+r++elat+ tLrqq +k++g+pn++laDfvap esg++Dy+G+F+vtag++ 
  lcl|NCBI__GCF_000018545.1:YP_002827542.1 1025 AGSAGDDIRLFTDERRERELATFFTLRQQLAKRDGRPNVALADFVAPVESGRRDYLGGFVVTAGIEE 1091
                                                ******************************************************************* PP

                              Met_synt_B12  135 eelakefeaekddYsailvkaladrLaeAfaellhekvrkelWgyakdeklsneelikekYqgiRpA 201 
                                                 ++a++fe+++ddYs+ilvkaladr+aeAfae++he vrkelWgya+de+++ +eli+e Y+giRpA
  lcl|NCBI__GCF_000018545.1:YP_002827542.1 1092 VAIAERFERANDDYSSILVKALADRFAEAFAERMHEYVRKELWGYAPDESFTPQELIAEPYTGIRPA 1158
                                                ******************************************************************* PP

                              Met_synt_B12  202 pGYpacpdhtekktlfelldaeekigieLteslamtPaasvsGlyfahpearyFavgkiekdqvedy 268 
                                                pGYpa+pdhtek+tlf+lldae++ig++Lte++am+P +svsGly+ hp+a yF+v+kie+dqvedy
  lcl|NCBI__GCF_000018545.1:YP_002827542.1 1159 PGYPAQPDHTEKETLFRLLDAEAAIGVRLTENYAMWPGSSVSGLYVGHPDAYYFGVAKIERDQVEDY 1225
                                                ******************************************************************* PP

                              Met_synt_B12  269 akrk 272 
                                                a+rk
  lcl|NCBI__GCF_000018545.1:YP_002827542.1 1226 ATRK 1229
                                                ***9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (273 nodes)
Target sequences:                          1  (1256 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 20.58
//
[ok]

This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory