Align [amino group carrier protein]-C-terminal-L-glutamyl-γ-L-lysine aminotransferase (EC 2.6.1.118; EC 2.6.1.124) (characterized)
to candidate YP_004139269.1 Mesci_0044 4-aminobutyrate aminotransferase
Query= metacyc::MONOMER-18314 (387 letters) >NCBI__GCF_000185905.1:YP_004139269.1 Length = 425 Score = 205 bits (522), Expect = 2e-57 Identities = 135/407 (33%), Positives = 209/407 (51%), Gaps = 38/407 (9%) Query: 5 QLYGDRGLTIVKGEAQYVWDIEGRRYLDFHTGIGVAFLGHRNPIILEYLKNQLENISILS 64 Q+Y DR E +WD+EGRRY+DF +GI V GHR+P ++E +K QL+ + Sbjct: 23 QIYADRA------ENSEIWDVEGRRYIDFSSGIAVVNTGHRHPRVIEAVKAQLDRFTHTC 76 Query: 65 TSFSTPIKD--EMLQALDKVKPDKMDN-AMLLNSGTEAVEAALKTARKITGRKKIIAFKN 121 P + + + L+ + P K + + + +G EAVE A+K AR TGR+ +IAF Sbjct: 77 HQV-VPYESYVRLAERLNGMLPGKFEKKTIFVTTGAEAVENAIKIARNATGRQAVIAFAG 135 Query: 122 AFHGRTAGSLSVTWN-------------KKYREPFE-PLVGPVEFLTFNNIEDLSKIDNE 167 FHGRT +++T Y PF PL G + ++ L K D + Sbjct: 136 GFHGRTFMGMALTGKVVPYKVGFGAMPGDVYHAPFPVPLHGVSVADSLAALDRLFKADVD 195 Query: 168 ---TAAVIVEPIQGESGVIPANIEFMKALKEKTENTGSLLIFDEIQTGFGRTGKLWAYKH 224 AA+I+EP+QGE G A +F+ AL++ + G LLI DE+QTGF RTGK++A H Sbjct: 196 PARVAAIIIEPVQGEGGFYDAPRDFLVALRKLCDQHGMLLIADEVQTGFARTGKMFAMDH 255 Query: 225 YNIVPDILTAGKAIGGGFPVSVVFLPDHIANKLEEGDHGSTYGGNPMAMAAVTAACKVIE 284 + + DI T K++ GGFP++ V I + G G TYGG+P+ +AA A VIE Sbjct: 256 HEVAADITTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGSPIGVAAAHAVLDVIE 315 Query: 285 KENVVEQANQKGQQFSNILVKNLADLKVVREVRGKGLMIGIDIR-----FQPGQVLKYLQ 339 E + ++AN G + L D+ + ++RG G M ++ ++ ++ Sbjct: 316 DEKLCDRANTLGARLKQRLQSIRDDVPEIVDIRGLGFMNAVEFNDVKKGLPSAEIANAIR 375 Query: 340 ----EKGILAVKAG--STVIRFLPSYLITYENMEEASNVLREGLLKI 380 +KG++ + G VIRFL I E M EA ++L + ++ Sbjct: 376 LKALDKGLILLTCGVYGNVIRFLAPITIQDEVMNEALDILESSIREV 422 Lambda K H 0.317 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 425 Length adjustment: 31 Effective length of query: 356 Effective length of database: 394 Effective search space: 140264 Effective search space used: 140264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory