Align 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase (EC 2.2.1.10) (characterized)
to candidate YP_004140837.1 Mesci_1631 deoxyribose-phosphate aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase
Query= BRENDA::Q57843 (273 letters) >NCBI__GCF_000185905.1:YP_004140837.1 Length = 280 Score = 98.6 bits (244), Expect = 1e-25 Identities = 81/270 (30%), Positives = 128/270 (47%), Gaps = 20/270 (7%) Query: 10 LGKLVRLERIFNRESEKTVIVPMDHGVSNGP--IKGLIDIRKTVNDVAEGGANAVLLHKG 67 + K VR+ R+F + + V +DHGV N P + GL D+ VN + + G +A+ ++ G Sbjct: 3 VNKKVRMNRLFG--GGRCLDVAIDHGVCNEPSFLAGLEDMASVVNQLVKAGPDAIQMNYG 60 Query: 68 IVRHGHRGYGKDV-GLIIHLSGGTA---ISPNPLKKVIVTTVEE---AIRMGADAVSIHV 120 GKD L++ + G I + V+ E AI M A V +++ Sbjct: 61 QADLLQAVPGKDKPALVMRIDMGNPYNRIRHRAMWAVLQNEAEPLLGAIEMDAACVVVNL 120 Query: 121 NVGSDED---WEAYRDLGMIAETCEYWGMPLIA---MMYPRGKH--IQNERDPELVAHAA 172 + DE + +++ + CE +G+PL+ M P +H + D + + Sbjct: 121 FMLPDEPDLFRQCVQNIARVRADCEKYGLPLMIEPLAMLPVTEHGGYMVDGDADKIVTLT 180 Query: 173 RLGAELGADIVKTSYTGDIDSFRDVVKGCPAPVVVAGGPKTNTDEEFLQMIKDAMEAGAA 232 RL E+GADIVK T D + F VV+ PV+V GG K + F M GA Sbjct: 181 RLAREMGADIVKADPTTDPNDFHRVVEAARCPVLVRGGGKEDLRAVF-DKSAALMAQGAL 239 Query: 233 GVAVGRNIFQHDDVVGITRAVCKIVHENAD 262 G+ GRNI+QH + + R + I+HE+AD Sbjct: 240 GMVYGRNIYQHANPSAVVRGLMAIIHEDAD 269 Lambda K H 0.318 0.138 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 280 Length adjustment: 25 Effective length of query: 248 Effective length of database: 255 Effective search space: 63240 Effective search space used: 63240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory