Align Ornithine aminotransferase; Orn-AT; Ornithine delta-aminotransferase; EC 2.6.1.13 (characterized)
to candidate YP_426342.1 Rru_A1254 aminotransferase
Query= SwissProt::O50131 (454 letters) >NCBI__GCF_000013085.1:YP_426342.1 Length = 464 Score = 172 bits (437), Expect = 2e-47 Identities = 141/441 (31%), Positives = 217/441 (49%), Gaps = 41/441 (9%) Query: 16 RKVIEEHHKYMATTTNDPNEYFL-VIERAEGVYWIDVDGNVLLDFSSGIGVMNVGLRNPK 74 +K+ +HH + T T N+ VI R EGVY D +GN +LD +G+ +N+G + Sbjct: 12 QKLDADHHWHPFTNTKALNQKGARVIVRGEGVYLWDSEGNRILDGMAGLWCVNLGYGRTE 71 Query: 75 VIEAIKKQLDLVLHAAGTDYYNPY-------QVELAKKLVEIAPGDIERKVFLSNSGTEA 127 + EA Q A +YN + VELA + + PGD+ VF ++SG+EA Sbjct: 72 LAEAAAAQF------ATLPFYNTFFQTTHTPAVELAHLIASVTPGDLNH-VFFASSGSEA 124 Query: 128 NEAALKIAK--W----STNRKMFIAFIGAFHGRTHGTMSLTASKPVQRSRMFPTMPGVVH 181 + AL++A+ W ++ I A+HG T SL+ + + P +P + H Sbjct: 125 VDTALRMARAYWVVAGKPSKTWVIGRKNAYHGSTLAGASLSGMSGMWKYGA-PLVPDIAH 183 Query: 182 VPYPNPYRNPWGIDGYENPDELINRV-IDYIEEYLFEHYVPAEEVAGIFFEPIQGEGGYV 240 + P Y D E E +E + E + AE VA EPIQG GG + Sbjct: 184 IAQPYWYGEA---DAAETDPEAFGLARARLLEAKILE--LGAENVAAFIGEPIQGAGGVI 238 Query: 241 VPPKNFFKELKKLADKHGILLIDDEVQMGMGRTGRMWAIEHFDIVPDIVTVAKALGGG-- 298 VPP +++ E++++ K+ +LLI DEV G GRTG + + F I PDI+T+AK L G Sbjct: 239 VPPASYWPEIERICRKYDVLLIADEVICGFGRTGSWFGSQTFGITPDIMTMAKGLSSGYL 298 Query: 299 ----IPIGATIFRADLDFGVSGVHSNTFGGNTVAAAAALAVIEELQN-GLIENA-QKLEP 352 + +G + ++ G H T+ G+ V+AA A IE L++ +IE + P Sbjct: 299 PISAVAVGNRVADELINGGGEFTHGFTYSGHPVSAAVAKRTIEILRDEKIIERVHDDIGP 358 Query: 353 LFRERLEEMKEKYEIIGDVRGLGLAWGVEFVKDRKTKEYATK--ERGEIVVE-ALKRGLA 409 F+ERL + E + ++G V G+GL G+ V + K + K E G I + GL Sbjct: 359 YFQERLRTL-EDHPLVGKVDGVGLIAGIALVASKSPKRFFEKGDEVGLICRDHCFAEGLV 417 Query: 410 LLGCGKSAIRLIPPLIISEEE 430 + G S + PPLIIS +E Sbjct: 418 MRAVG-SRMVCAPPLIISRDE 437 Lambda K H 0.319 0.139 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 474 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 454 Length of database: 464 Length adjustment: 33 Effective length of query: 421 Effective length of database: 431 Effective search space: 181451 Effective search space used: 181451 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory