Align aspartate-prephenate aminotransferase (EC 2.6.1.78) (characterized)
to candidate YP_427510.1 Rru_A2423 aminotransferase
Query= BRENDA::Q56232 (385 letters) >NCBI__GCF_000013085.1:YP_427510.1 Length = 395 Score = 175 bits (443), Expect = 2e-48 Identities = 125/370 (33%), Positives = 179/370 (48%), Gaps = 11/370 (2%) Query: 13 PSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTKYAPPAGIPE 72 P + V A E G +++ L G+P PE + R L G Y G+ Sbjct: 23 PFIVMDVMRAAAEREATGAEVMHLEVGQPSTGLPEQALDEVARRLHSGPMGYTVALGLDA 82 Query: 73 LREALAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMV 132 LREA+A ++R G++V P IVT G F A + GD V + +P + +Y ++ Sbjct: 83 LREAIALHYQRTQGVAVDPGRIIVTTGSSAGFILAFLAAFEAGDRVGLAAPGYPAYRHIL 142 Query: 133 RFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARL 192 + G V + T PE + P + A L+V SP NPTG V P L+AL Sbjct: 143 KALGCEPVILPTGPETRYQPTVAVLEEA-GMDLDGLIVASPANPTGTVMPAADLKALVAY 201 Query: 193 AVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEV 252 E L+SDEIY + Y S +A EH + VN +K F MTGWR+G+ P ++ Sbjct: 202 CGERGIRLISDEIYHGITYGEAALSTVGLA-EHPVVVNSFSKYFCMTGWRLGWLVLPPDL 260 Query: 253 IKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGL 312 ++ + ++ SP ++Q+A L AL + AF E R Y R R +LL+ L A G Sbjct: 261 LRPVECLTQNLFISPPALSQYAGLAALRHH---GAFEENIRR-YARNRQILLDALPAAGF 316 Query: 313 KAVRPS-GAFYVLMDTSPIAPDEVRAAERLL-EAGVAVVPGTDF--AAFGH-VRLSYATS 367 A P+ GAFY+ D S + D + R+L E GVA PG DF A H VR S++ + Sbjct: 317 GAFAPADGAFYLYGDVSGLTDDSLGFCARMLAETGVAATPGLDFDDARGAHFVRFSFSGA 376 Query: 368 EENLRKALER 377 E + KA R Sbjct: 377 TETIEKAARR 386 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 395 Length adjustment: 31 Effective length of query: 354 Effective length of database: 364 Effective search space: 128856 Effective search space used: 128856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory