Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate NP_662292.1 CT1406 3-dehydroquinate synthase
Query= BRENDA::Q3M4V2 (363 letters) >NCBI__GCF_000006985.1:NP_662292.1 Length = 368 Score = 256 bits (655), Expect = 5e-73 Identities = 148/358 (41%), Positives = 216/358 (60%), Gaps = 8/358 (2%) Query: 9 LPTQSYEIAIAPASLDQIGQSLAGLKLGKKVLLVSNPTIFKHFGKVAVDSLEAAGFQVAS 68 + T S I + +D +G+ A LGKK +L+ + + FG ++S++ GF+ Sbjct: 1 MQTPSSHIIVRTPVIDSVGELYATRGLGKKTVLLFDENTRRLFGDAIIESMQRQGFRTIE 60 Query: 69 YCLPAGERYKTLNSIQKLYDIALENRLERSSTMVALGGGVIGDMTGFAAATWLRGINVVQ 128 +PA E K++++ KLY +E ++RS ++ GGGV+GD+ G+ AA++ RGI VVQ Sbjct: 61 LVVPARETSKSVSTAWKLYGQMIEADVDRSWNLLCAGGGVVGDLGGYIAASYYRGIPVVQ 120 Query: 129 VPTTLLAMVDSAIGGKTGVNHPHGKNLIGAFHQPRFVLIDPQVLKTLPVREFRAGMAEVI 188 +PTTLLAM DS+IGGK +NHP GKNLIG FH P VLIDP L+TLP RE GM+EV+ Sbjct: 121 LPTTLLAMTDSSIGGKVAINHPLGKNLIGFFHMPELVLIDPAYLRTLPSREIYGGMSEVV 180 Query: 189 KYGVIWDAELFNQLEQSKRLDQLRYIKPELMDAILTRSCQAKADVVGKDEKE-GGLRAIL 247 KYG I D E F+ L +K D++ ++ + ++RS KA+VV KD +E GLRA L Sbjct: 181 KYGFIADREFFDLL--TKHWDEVVRLEEPWLSKAVSRSAFIKANVVEKDFRETSGLRATL 238 Query: 248 NYGHTVGHAVESLTNYRLLKHGEAVGIGMVAAGQIAVNLGLWQQADADRQNALIEK---- 303 N+GHT H +E + YR L+HGEAV IGMV A ++ G +AD AL+ + Sbjct: 239 NFGHTFAHGLEKMAGYRNLRHGEAVTIGMVCALFLSHRPGFLAEADLREGLALLARFRFP 298 Query: 304 AGLPTKLPAGLDIEGIIEALQLDKKVKDGKVRFVLPTQIGVVTVTD-EVTSDHIRQVL 360 GL K LD + ++E++ DKK D ++RFVL +IG + D ++T + Q + Sbjct: 299 RGLVNKRFLSLDRDELVESMLSDKKKIDKQLRFVLLDRIGHAFLHDKDITKTDVLQAI 356 Lambda K H 0.319 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 368 Length adjustment: 30 Effective length of query: 333 Effective length of database: 338 Effective search space: 112554 Effective search space used: 112554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate NP_662292.1 CT1406 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.19258.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-121 389.5 0.0 8.4e-121 389.3 0.0 1.0 1 lcl|NCBI__GCF_000006985.1:NP_662292.1 CT1406 3-dehydroquinate synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000006985.1:NP_662292.1 CT1406 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 389.3 0.0 8.4e-121 8.4e-121 2 343 .. 7 356 .. 6 357 .. 0.96 Alignments for each domain: == domain 1 score: 389.3 bits; conditional E-value: 8.4e-121 TIGR01357 2 kvkvgegllkklveelae..kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletvakl 71 +++v++ +++++ e +a+ +k+v+++de++++l+++ + e +++g+++++lvvp++e+sKs++t++kl lcl|NCBI__GCF_000006985.1:NP_662292.1 7 HIIVRTPVIDSVGELYATrgLGKKTVLLFDENTRRLFGDAIIESMQRQGFRTIELVVPARETSKSVSTAWKL 78 689999******9999995445***************99998888888************************ PP TIGR01357 72 ldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgkNliGa 143 + q++e++++r++ l++ GGGvvgDl+G++Aa+y+RGi++vq+PTtllam Dss+GGK++in+plgkNliG lcl|NCBI__GCF_000006985.1:NP_662292.1 79 YGQMIEADVDRSWNLLCAGGGVVGDLGGYIAASYYRGIPVVQLPTTLLAMTDSSIGGKVAINHPLGKNLIGF 150 ************************************************************************ PP TIGR01357 144 fyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeelikrsievKa 215 f++P++Vlid+++l+tlp+re++ Gm+Ev+K+g+iad+e+f+ l+k+++++++l e+ +l+++++rs +Ka lcl|NCBI__GCF_000006985.1:NP_662292.1 151 FHMPELVLIDPAYLRTLPSREIYGGMSEVVKYGFIADREFFDLLTKHWDEVVRL-EEPWLSKAVSRSAFIKA 221 *************************************************99986.66*************** PP TIGR01357 216 evVeeDekes.glRalLNfGHtlgHaiEallkyk.lsHGeaVaiGmvveaklseklgllkaellerlvallk 285 +vVe+D +e+ glRa+LNfGHt++H++E++++y+ l+HGeaV+iGmv+++ ls++ g+l + +l++ +all lcl|NCBI__GCF_000006985.1:NP_662292.1 222 NVVEKDFRETsGLRATLNFGHTFAHGLEKMAGYRnLRHGEAVTIGMVCALFLSHRPGFLAEADLREGLALLA 293 *********99************************************************************* PP TIGR01357 286 klglptklkk....klsveellkallkDKKnegskiklvlleeiGkaalas.evteeelleal 343 ++ p+ l + +l+ +el++++l+DKK+ ++++++vll++iG+a+l++ ++t++++l+a+ lcl|NCBI__GCF_000006985.1:NP_662292.1 294 RFRFPRGLVNkrflSLDRDELVESMLSDKKKIDKQLRFVLLDRIGHAFLHDkDITKTDVLQAI 356 *****9998889999**********************************99899999988865 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (368 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.85 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory