Align Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 (characterized)
to candidate NP_662805.1 CT1928 aspartate-semialdehyde dehydrogenase
Query= SwissProt::P23247 (337 letters) >NCBI__GCF_000006985.1:NP_662805.1 Length = 338 Score = 328 bits (841), Expect = 1e-94 Identities = 184/333 (55%), Positives = 225/333 (67%), Gaps = 8/333 (2%) Query: 5 FNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDW 64 + VA+ GATG VG TM++VL+ER FPV EL LAS RS G+ FNG+ + + Sbjct: 7 YRVAVLGATGLVGRTMIKVLEERNFPVSELVPLASPRSRGEVITFNGREFVTEVPSAEIF 66 Query: 65 SQVHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAI--AEFR 122 V IALFSAG +S +WAP+AAEAG +VIDN+S FR D IPLVVPEVNPE I E + Sbjct: 67 KGVDIALFSAGATVSKEWAPVAAEAGAIVIDNSSAFRMDEGIPLVVPEVNPETIFDREGK 126 Query: 123 NRNIIANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNG 182 IIANPNCSTIQM+V LKP+YDA GI R+ V+TYQSV+G GKAG D L + A G Sbjct: 127 AAPIIANPNCSTIQMVVVLKPLYDAYGIRRVVVSTYQSVTGKGKAGRDALESELA----G 182 Query: 183 YPAETNTFSQQIAFNCIPQIDQFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVF 242 + T QIAFN +PQID F +NGYTKEEMKMV ET+KI D +I V+PT VR+PV+ Sbjct: 183 NIPDEFTHFHQIAFNAVPQIDAFTENGYTKEEMKMVNETKKIMGDDTIQVSPTTVRIPVY 242 Query: 243 YGHAEAVHVETRAPIDAEQVMDMLEQTDGIEL--FRGADFPTQVRDAGGKDHVLVGRVRN 300 GH EA++VE R+ D +QV +L + GI + A + +D V VGR+R Sbjct: 243 GGHGEALNVELRSDFDIDQVRALLAGSPGIVMQDDPSARLYPMPMTSYERDEVFVGRLRP 302 Query: 301 DISHHSGINLWVVADNVRKGAATNAVQIAELLV 333 D H +NLWVVADN+RKGAATNAVQIAELLV Sbjct: 303 DYWHPRTLNLWVVADNLRKGAATNAVQIAELLV 335 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 338 Length adjustment: 28 Effective length of query: 309 Effective length of database: 310 Effective search space: 95790 Effective search space used: 95790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate NP_662805.1 CT1928 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.1035.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-136 439.5 0.0 6.4e-136 438.8 0.0 1.3 1 lcl|NCBI__GCF_000006985.1:NP_662805.1 CT1928 aspartate-semialdehyde de Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000006985.1:NP_662805.1 CT1928 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 438.8 0.0 6.4e-136 6.4e-136 1 338 [. 8 336 .. 8 337 .. 0.96 Alignments for each domain: == domain 1 score: 438.8 bits; conditional E-value: 6.4e-136 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsaGgs 72 +va++GatG vG++++kvLeernfp+++lv+las rs+G+ ++f+g+e+ e + e f+g+dialfsaG++ lcl|NCBI__GCF_000006985.1:NP_662805.1 8 RVAVLGATGLVGRTMIKVLEERNFPVSELVPLASPRSRGEVITFNGREFVTEVPSAEIFKGVDIALFSAGAT 79 69***********************************************99999999*************** PP TIGR01296 73 vskefapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkg..iianPnCstiqlvvvLkplkde 142 vske+ap aa+ag+iviDn+safr+de +PLvvpevn e++++++ k iianPnCstiq+vvvLkpl+d+ lcl|NCBI__GCF_000006985.1:NP_662805.1 80 VSKEWAPVAAEAGAIVIDNSSAFRMDEGIPLVVPEVNPETIFDREGKAapIIANPNCSTIQMVVVLKPLYDA 151 *****************************************999876444********************** PP TIGR01296 143 aklkrvvvstYqavsGaGkkgveeLknqtkavlegkekepeidalkakkfakqiafnaiplidklkedGytk 214 ++++rvvvstYq+v G Gk+g + L++++ + + ++ +qiafna+p+id ++e+Gytk lcl|NCBI__GCF_000006985.1:NP_662805.1 152 YGIRRVVVSTYQSVTGKGKAGRDALESELAGNIPDE-----------FTHFHQIAFNAVPQIDAFTENGYTK 212 *************************99987766433...........35679******************** PP TIGR01296 215 eelkllfetrkilgiedlkvsatcvrvPvftghsesvsiefekelsveevkelLkeapgvvviddpsenlyp 286 ee+k+++et+ki+g++ ++vs t+vr+Pv+ gh e++++e+ ++++++v+ lL ++pg+v++ddps +lyp lcl|NCBI__GCF_000006985.1:NP_662805.1 213 EEMKMVNETKKIMGDDTIQVSPTTVRIPVYGGHGEALNVELRSDFDIDQVRALLAGSPGIVMQDDPSARLYP 284 ************************************************************************ PP TIGR01296 287 tPleavgkdevfvgrirkDlskekglalfvvaDnlrkGaalnavqiaellik 338 +P++ ++devfvgr+r D + ++l+l+vvaDnlrkGaa+navqiaell+ lcl|NCBI__GCF_000006985.1:NP_662805.1 285 MPMTSYERDEVFVGRLRPDYWHPRTLNLWVVADNLRKGAATNAVQIAELLVG 336 *************************************************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (338 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.05 # Mc/sec: 2.17 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory