Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate NP_662910.1 CT2035 threonine synthase
Query= BRENDA::P00934 (428 letters) >NCBI__GCF_000006985.1:NP_662910.1 Length = 441 Score = 333 bits (854), Expect = 6e-96 Identities = 182/416 (43%), Positives = 254/416 (61%), Gaps = 9/416 (2%) Query: 1 MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS 60 M Y+ + V+ +A +GL + GL+ P +P FS EI + F + + Sbjct: 1 MIFYSTTKASAPVTMKKATLEGLAPDGGLYVPSTMPHFSAEEIALLENGSFNNIAFAVAK 60 Query: 61 AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH 120 F GDEIP + L E + F F P+ ++ D ELFHGPTLAFKD+G RF+A+M + Sbjct: 61 KFAGDEIPLDRLSELIDECFTFDTPLHELDPDTFVEELFHGPTLAFKDYGARFLARMTGY 120 Query: 121 IAGDKP--VTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIE 178 A ++ +T+L ATSGDTG+AVA+ F+G+PN +VV+LYP GK+S LQE+ T G N+ Sbjct: 121 FAAEESRLITVLVATSGDTGSAVAYGFHGIPNTRVVLLYPSGKVSRLQEQQLTTAGDNVF 180 Query: 179 TVAIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETR 238 + + GDFD CQ LVKQAF D+ L+ L L SANSINISRL+ Q YY A QL Q Sbjct: 181 ALEVKGDFDDCQRLVKQAFVDQSLRQKLTLTSANSINISRLIPQSFYYAWAALQLRQRKP 240 Query: 239 NQL-VVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATL 297 + L + SVPSGN+G+LTAG++AK +G P+ FIAA+N ND+V R+L +G++ PK T TL Sbjct: 241 DALPIFSVPSGNYGNLTAGVMAKMMGFPIGHFIAASNANDSVTRYLDEGRYEPKPTVRTL 300 Query: 298 SNAMDVSQPNNWPRVEELFRRKIWQL-KELGYAAVDDETTQQTMRELKE-LGYTSEPHAA 355 + AMDV P+N+ R+ F ++ +E+ AV D T +T+R + E GY +PH A Sbjct: 301 TTAMDVGNPSNFARLRYFFENDFRKMGQEITGIAVSDAETLETIRSVYEKYGYVMDPHTA 360 Query: 356 VAYRAL----RDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLP 407 V YRAL +D G G+ L TAHP KF E+++ G + LP+ + E P Sbjct: 361 VGYRALDRFRQDHAGAGTPGVVLSTAHPVKFDEAIKEATGNEVPLPETMEEIMSKP 416 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 449 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 428 Length of database: 441 Length adjustment: 32 Effective length of query: 396 Effective length of database: 409 Effective search space: 161964 Effective search space used: 161964 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate NP_662910.1 CT2035 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.8633.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-89 284.5 0.0 7.4e-89 284.2 0.0 1.0 1 lcl|NCBI__GCF_000006985.1:NP_662910.1 CT2035 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000006985.1:NP_662910.1 CT2035 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 284.2 0.0 7.4e-89 7.4e-89 12 339 .. 66 406 .. 58 407 .. 0.90 Alignments for each domain: == domain 1 score: 284.2 bits; conditional E-value: 7.4e-89 TIGR00260 12 ekdlvdlaegstelfrspklaeevgaenlyvkelfhgPtlaFKDrglqfvavlltkalelgne..tvlcAts 81 e++l l e e f+++++ +e+ + +v elfhgPtlaFKD g +f+a + +++ + tvl+Ats lcl|NCBI__GCF_000006985.1:NP_662910.1 66 EIPLDRLSELIDECFTFDTPLHELDP-DTFVEELFHGPTLAFKDYGARFLARMTGYFAAEESRliTVLVATS 136 5677888999999************9.****************************9998888778******* PP TIGR00260 82 GdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDdaqdlvkeifedke...kl 150 Gdtg+a+a+++ g +n +vv LyP+gk+s ++e+ +t+ n+ l++kGdFDd+q+lvk++f d+ kl lcl|NCBI__GCF_000006985.1:NP_662910.1 137 GDTGSAVAYGFHGIPNTRVVLLYPSGKVSRLQEQQLTTAGDNVFALEVKGDFDDCQRLVKQAFVDQSlrqKL 208 *******************************99999***************************9655566** PP TIGR00260 151 klnsvNsinparieaqk.tyafeiveqlgkespdkv.vvpvpsgnfgailkGflekkelglpieklaiaaeg 220 l s+Nsin++r+ q +ya+ +++ + ++pd + +++vpsgn g++++G + +k++g p +iaa + lcl|NCBI__GCF_000006985.1:NP_662910.1 209 TLTSANSINISRLIPQSfYYAWAALQLRQ-RKPDALpIFSVPSGNYGNLTAG-VMAKMMGFP-IGHFIAASN 277 *****************9****9997665.788887589*************.6777777**.678899999 PP TIGR00260 221 aadivrrflksgdlepkedkeTlstAmdignpsnverale....larrslgnledlkesvsdeeileaikkl 288 a+d v+r+l +g epk ++ Tl tAmd+gnpsn+ r+ +r+ +++++ + +vsd+e+le+i+ + lcl|NCBI__GCF_000006985.1:NP_662910.1 278 ANDSVTRYLDEGRYEPKPTVRTLTTAMDVGNPSNFARLRYffenDFRKMGQEITGI--AVSDAETLETIRSV 347 99***********************************9983334455555555655..************** PP TIGR00260 289 aeeegyllephtavavaalkklvekg..vs......atadpaKFeevvealtgnklkdp 339 +e+ gy+++phtav+++al + ++ + +ta+p KF e++ tgn+ p lcl|NCBI__GCF_000006985.1:NP_662910.1 348 YEKYGYVMDPHTAVGYRALDRFRQDHagAGtpgvvlSTAHPVKFDEAIKEATGNEVPLP 406 *******************99888775522556778*****************998776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (441 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.31 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory