Align 3-dehydroquinate dehydratase; 3-dehydroquinase; EC 4.2.1.10; Type I DHQase; Type I dehydroquinase; DHQ1 (uncharacterized)
to candidate WP_011033220.1 MM_RS06585 3-dehydroquinase
Query= curated2:Q8PXE7 (242 letters) >NCBI__GCF_000007065.1:WP_011033220.1 Length = 242 Score = 463 bits (1191), Expect = e-135 Identities = 242/242 (100%), Positives = 242/242 (100%) Query: 1 MTQIGSFDLEKKTAVVAVILEKPLENSKKAAEKGADILEIRLDLLGIRTPERAAEVIREI 60 MTQIGSFDLEKKTAVVAVILEKPLENSKKAAEKGADILEIRLDLLGIRTPERAAEVIREI Sbjct: 1 MTQIGSFDLEKKTAVVAVILEKPLENSKKAAEKGADILEIRLDLLGIRTPERAAEVIREI 60 Query: 61 KAETGIPIIVTSRSGAEGGKWDGKEEDRTGLLINLLSLKDGPDAIDIELSAGMKERNRVI 120 KAETGIPIIVTSRSGAEGGKWDGKEEDRTGLLINLLSLKDGPDAIDIELSAGMKERNRVI Sbjct: 61 KAETGIPIIVTSRSGAEGGKWDGKEEDRTGLLINLLSLKDGPDAIDIELSAGMKERNRVI 120 Query: 121 KAAKDRETAVIVSSHDFLKTPPLQNMRTIIEEMFLAGADIAKLAVMPLSVGDTLNLLRVT 180 KAAKDRETAVIVSSHDFLKTPPLQNMRTIIEEMFLAGADIAKLAVMPLSVGDTLNLLRVT Sbjct: 121 KAAKDRETAVIVSSHDFLKTPPLQNMRTIIEEMFLAGADIAKLAVMPLSVGDTLNLLRVT 180 Query: 181 LDFKDAGKSVCTIAMGSQGKHTRVVAPFYGSVLTYASIESNASAAPGQLPVDEVKKIMEM 240 LDFKDAGKSVCTIAMGSQGKHTRVVAPFYGSVLTYASIESNASAAPGQLPVDEVKKIMEM Sbjct: 181 LDFKDAGKSVCTIAMGSQGKHTRVVAPFYGSVLTYASIESNASAAPGQLPVDEVKKIMEM 240 Query: 241 LK 242 LK Sbjct: 241 LK 242 Lambda K H 0.315 0.133 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 242 Length adjustment: 23 Effective length of query: 219 Effective length of database: 219 Effective search space: 47961 Effective search space used: 47961 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
Align candidate WP_011033220.1 MM_RS06585 (3-dehydroquinase)
to HMM TIGR01093 (aroD: 3-dehydroquinate dehydratase, type I (EC 4.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01093.hmm # target sequence database: /tmp/gapView.20050.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01093 [M=229] Accession: TIGR01093 Description: aroD: 3-dehydroquinate dehydratase, type I Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-54 171.0 0.0 2.7e-54 170.7 0.0 1.0 1 lcl|NCBI__GCF_000007065.1:WP_011033220.1 MM_RS06585 3-dehydroquinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000007065.1:WP_011033220.1 MM_RS06585 3-dehydroquinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 170.7 0.0 2.7e-54 2.7e-54 8 228 .. 17 237 .. 13 238 .. 0.90 Alignments for each domain: == domain 1 score: 170.7 bits; conditional E-value: 2.7e-54 TIGR01093 8 akdleealeelekikevgaDivElRvDllkdvsseksveavaeqlsellkdlplilTiRtqkeGGkfkg 76 a le+ le+ +k++e+gaDi+E+R+Dll e+ +v++++ ++ + +p+i+T R+ eGGk++g lcl|NCBI__GCF_000007065.1:WP_011033220.1 17 AVILEKPLENSKKAAEKGADILEIRLDLLGIRTPER-AAEVIREI-KAETGIPIIVTSRSGAEGGKWDG 83 5557888899999999*************9999986.55555555.35599****************** PP TIGR01093 77 deeerleelkeai.eknlvdlvDiElkleeeavkelikeakkaktkiilSnHdfektpskeelverlek 144 +ee+r +l +++ k ++d +DiEl++ + + +ik ak+ +t +i+S+Hdf ktp+ ++++ ++e+ lcl|NCBI__GCF_000007065.1:WP_011033220.1 84 KEEDRTGLLINLLsLKDGPDAIDIELSAGMKERNRVIKAAKDRETAVIVSSHDFLKTPPLQNMRTIIEE 152 ***999887766516889*************************************************** PP TIGR01093 145 aqsldaDivKiavmaksieDvltLleitlkveeekdkplialsMgekGkisRvlgavlgsvltfg..sl 211 + +aDi+K+avm+ s+ D l+Ll++tl + + k + ++ Mg++Gk +Rv++ + gsvlt++ ++ lcl|NCBI__GCF_000007065.1:WP_011033220.1 153 MFLAGADIAKLAVMPLSVGDTLNLLRVTLDFK-DAGKSVCTIAMGSQGKHTRVVAPFYGSVLTYAsiES 220 *******************************5.889*****************************5455 PP TIGR01093 212 gkasAPGQisvkelrel 228 + ++APGQ+ v+e++++ lcl|NCBI__GCF_000007065.1:WP_011033220.1 221 NASAAPGQLPVDEVKKI 237 6678**********997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (229 nodes) Target sequences: 1 (242 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.04 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory