Align Homocysteine formation from aspartate semialdehyde (DUF39 component) (characterized)
to candidate WP_011032089.1 MM_RS00690 methanogenesis marker 16 metalloprotein
Query= reanno::Miya:8500721 (390 letters) >NCBI__GCF_000007065.1:WP_011032089.1 Length = 438 Score = 134 bits (338), Expect = 4e-36 Identities = 104/347 (29%), Positives = 163/347 (46%), Gaps = 43/347 (12%) Query: 2 ASFKVNKTIAEINERIRQGKAVVLNAEEMTEAVRRMGKEKAAREIDVVTTGTFSPMCSSG 61 A+ + ++TI EI +I G+AVV AEE++ +R G+E ++DVVTT T M + Sbjct: 6 ANIEEHRTILEIQAKIDAGEAVVFTAEEISSRIRA-GEEIGLEDVDVVTTATRGIMSGTY 64 Query: 62 LLFNIGQQDPPT-LKTAKVWMNDVPAYAG------LAAVDSYLGATEPTEDDPLNKVYPG 114 +F+ +P + +K ++V++N VPA G L +D + T + DP Sbjct: 65 AVFSFKVSEPDSFIKASEVFLNGVPAVVGPCPNERLGVLDIIVLGTAHSVSDP------- 117 Query: 115 RFKYGGGHVIEDLVRGKAVHLRAEAYGTDCYPRKSLDKKITLSELPYAHLLNPRNCYQNY 174 +YGGGH+ D+V GK + + C+ ++ LSE+P+A L R+ ++NY Sbjct: 118 --RYGGGHLFRDMVEGKIIRVDVTTNEGKCFSVETC-----LSEIPFARLYATRHAFKNY 170 Query: 175 NAAVNLTSRIIYTYMG--PLKPNLRNVNFATAGRISPLFNDPLFRTIGLGTRIFLGGGTG 232 A VN I T P + R + F G ++P+ N P TIG+GTR+ + G G Sbjct: 171 RAFVNPGKDPIDTIFHALPFEGEFREMTFCGCGELNPIENVPGLETIGIGTRVLINGAEG 230 Query: 233 YVLGAGTQHVAAPKRTERGLPLSPAGTLMLKGDLKGMNARYLRGLSFLGYGCSLAVGVGI 292 +V G GT R +P +P L DL M Y+ G G G + + Sbjct: 231 FVTGQGT----------RSVPDNP--NLTGFADLHDMVPEYMGGFVTSG-GPEIINTWAV 277 Query: 293 PIPILNEEIAWFTGVDDSDIQMPVKDYGHDYPNCLPRVIQHVTYEDL 339 PIP+L+ + DS I + + D P C +TY D+ Sbjct: 278 PIPVLSRSMLENILKLDSQIPLKLVDLAGRIPLC------DITYGDV 318 Score = 24.3 bits (51), Expect = 0.007 Identities = 11/24 (45%), Positives = 15/24 (62%) Query: 362 SLEVANTLKSWIEKGEFLLTEPVE 385 +++ A LK + G F LTEPVE Sbjct: 409 AVKAAQELKEQLLTGRFRLTEPVE 432 Lambda K H 0.318 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 390 Length of database: 438 Length adjustment: 31 Effective length of query: 359 Effective length of database: 407 Effective search space: 146113 Effective search space used: 146113 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory