Align 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (characterized)
to candidate WP_050738184.1 MCA_RS06960 3-phosphoshikimate 1-carboxyvinyltransferase
Query= BRENDA::Q83E11 (438 letters) >NCBI__GCF_000008325.1:WP_050738184.1 Length = 437 Score = 471 bits (1212), Expect = e-137 Identities = 242/425 (56%), Positives = 305/425 (71%), Gaps = 2/425 (0%) Query: 7 PSQGLSGEICVPGDKSISHRAVLLAAIAEGQTQVDGFLMGADNLAMVSALQQMGASIQVI 66 P + G+I VPGDKSISHR+V+L ++AEG T+V GFL D LA ++A + MG I+ Sbjct: 12 PGGRMQGDIRVPGDKSISHRSVMLGSLAEGVTEVSGFLQAEDCLATMAAFRAMGVEIEG- 70 Query: 67 EDENILVVEGVGMTGLQAPPEALDCGNSGTAIRLLSGLLAGQPFNTVLTGDSSLQRRPMK 126 E L + GVG+ GL+ P LD GNSGT++RLLSGLLAGQ F+T LTGD+SL RRPM+ Sbjct: 71 PTEGRLRIHGVGLHGLKPPAAPLDLGNSGTSMRLLSGLLAGQAFDTTLTGDASLVRRPMR 130 Query: 127 RIIDPLTLMGAKIDST-GNVPPLKIYGNPRLTGIHYQLPMASAQVKSCLLLAGLYARGKT 185 R+ +PL MGA+ID+T PL+I G RL GI Y +P+ASAQVKSCLLLAGLYA GKT Sbjct: 131 RVTEPLRAMGARIDTTEAGTAPLRIAGGSRLKGIDYAMPVASAQVKSCLLLAGLYAEGKT 190 Query: 186 CITEPAPSRDHTERLLKHFHYTLQKDKQSICVSGGGKLKANDISIPGDISSAAFFIVAAT 245 C+TEPAP+RDHTER+L F Y + +D +C+ GGKL A I +P DISSAAFF++ A Sbjct: 191 CVTEPAPTRDHTERMLAGFGYPVARDGNRVCIQSGGKLSATRIDVPADISSAAFFMIGAA 250 Query: 246 ITPGSAIRLCRVGVNPTRLGVINLLKMMGADIEVTHYTEKNEEPTADITVRHARLKGIDI 305 I+PGS + L VG+NPTR GVI +L+ MGADIE+ E EP AD+ +R+ L+GI I Sbjct: 251 ISPGSDVFLRHVGINPTRTGVIEILREMGADIEILAPREVGGEPVADLRIRYRELRGIRI 310 Query: 306 PPDQVPLTIDEFPVLLIAAAVAQGKTVLRDAAELRVKETDRIAAMVDGLQKLGIAAESLP 365 P VPL IDEFP L IAAA A G+TVL A ELRVKE+DRI AM DGL LGI A P Sbjct: 311 PEHTVPLAIDEFPALFIAAACATGETVLTGAEELRVKESDRIQAMADGLTTLGIDARPTP 370 Query: 366 DGVIIQGGTLEGGEVNSYDDHRIAMAFAVAGTLAKGPVRIRNCDNVKTSFPNFVELANEV 425 DG++I+GG+ GG V+S DHRIAM+F++A A P+ I +C NV TSFPNFVELA + Sbjct: 371 DGMVIRGGSFRGGAVDSRGDHRIAMSFSIAALRAPIPIEIHDCANVATSFPNFVELARTL 430 Query: 426 GMNVK 430 G++++ Sbjct: 431 GLDIE 435 Lambda K H 0.318 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 644 Number of extensions: 35 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 437 Length adjustment: 32 Effective length of query: 406 Effective length of database: 405 Effective search space: 164430 Effective search space used: 164430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_050738184.1 MCA_RS06960 (3-phosphoshikimate 1-carboxyvinyltransferase)
to HMM TIGR01356 (aroA: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01356.hmm # target sequence database: /tmp/gapView.25702.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01356 [M=415] Accession: TIGR01356 Description: aroA: 3-phosphoshikimate 1-carboxyvinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-130 421.4 0.0 2e-130 421.3 0.0 1.0 1 lcl|NCBI__GCF_000008325.1:WP_050738184.1 MCA_RS06960 3-phosphoshikimate 1 Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000008325.1:WP_050738184.1 MCA_RS06960 3-phosphoshikimate 1-carboxyvinyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 421.3 0.0 2e-130 2e-130 1 413 [. 18 431 .. 18 433 .. 0.96 Alignments for each domain: == domain 1 score: 421.3 bits; conditional E-value: 2e-130 TIGR01356 1 geikipgsKSishRalllaaLaegetvvtnlLkseDtlatlealrklGakve.eekeelviegvgg..l 66 g+i++pg+KSishR+++l++Laeg t+v ++L++eD+lat+ a+r++G+++e ++++l i+gvg l lcl|NCBI__GCF_000008325.1:WP_050738184.1 18 GDIRVPGDKSISHRSVMLGSLAEGVTEVSGFLQAEDCLATMAAFRAMGVEIEgPTEGRLRIHGVGLhgL 86 79**************************************************7669********98889 PP TIGR01356 67 kepeaeldlgnsGttaRlltgvlalasgevvltgdeslkkRPierlveaLrelgaeieskeeegslPla 135 k p a ldlgnsGt++Rll+g+la ++++++ltgd sl +RP++r++e+Lr++ga+i+ +e +g++Pl+ lcl|NCBI__GCF_000008325.1:WP_050738184.1 87 KPPAAPLDLGNSGTSMRLLSGLLAGQAFDTTLTGDASLVRRPMRRVTEPLRAMGARIDTTE-AGTAPLR 154 **********************************************************988.69***** PP TIGR01356 136 isgplkg.givelsgsaSsQyksalllaaplalqavtleivgeklisrpyieitLkllksfgveveeed 203 i g++++ gi + + aS+Q+ks+llla+ l a++ + v+e+ +r+++e++L+ ++ v ++ lcl|NCBI__GCF_000008325.1:WP_050738184.1 155 IAGGSRLkGIDYAMPVASAQVKSCLLLAG---LYAEGKTCVTEPAPTRDHTERMLAGFGYP---VARDG 217 ****9999*********************...7778999***************9988866...99987 PP TIGR01356 204 erkivvkggqkykqkevevegDaSsAafflaaaaitge.evtvenlgenstqgdkaiiivLeemGadve 271 + ++ ++ g+k ++++v++D+SsAaff++ aai+++ +v ++++g+n+t+++ +i++L+emGad+e lcl|NCBI__GCF_000008325.1:WP_050738184.1 218 N-RVCIQSGGKLSATRIDVPADISSAAFFMIGAAISPGsDVFLRHVGINPTRTG--VIEILREMGADIE 283 6.9******9988888**********************9***************..888********** PP TIGR01356 272 veeqr........dvevegasklkgvkv.didvdsliDelptlavlaafAegetriknieelRvkEsdR 331 + + r d++++ ++l+g+++ ++ v+ +iDe+p+l ++aa+A get+++++eelRvkEsdR lcl|NCBI__GCF_000008325.1:WP_050738184.1 284 ILAPRevggepvaDLRIR-YRELRGIRIpEHTVPLAIDEFPALFIAAACATGETVLTGAEELRVKESDR 351 **9999************.689******99*************************************** PP TIGR01356 332 iaaiaeeLeklGveveeledgllieGkkkelkgavvdtydDHRiamalavlglaaegeveiedaecvak 400 i+a+a+ L++lG+++++++dg++i+G+ +++g+ vd+ +DHRiam++++++l+a ++ei+d + va+ lcl|NCBI__GCF_000008325.1:WP_050738184.1 352 IQAMADGLTTLGIDARPTPDGMVIRGG--SFRGGAVDSRGDHRIAMSFSIAALRAPIPIEIHDCANVAT 418 ***************************..6*************************************** PP TIGR01356 401 sfPeFfevleqlg 413 sfP+F+e++++lg lcl|NCBI__GCF_000008325.1:WP_050738184.1 419 SFPNFVELARTLG 431 *******999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (415 nodes) Target sequences: 1 (437 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.80 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory